Property Summary

NCBI Gene PubMed Count 8
Grant Count 5
R01 Count 1
Funding $344,282
PubMed Score 330.01
PubTator Score 3.09

Knowledge Summary

Patent

No data available

Gene RIF (7)

PMID Text
26416420 PDGF upregulates the expression of CLEC-2 on dendritic cells to induce T regulatory cells.
25510854 Key residues at the membrane-distal surface of KACL, but not glycosylation, determine the functional interaction of the keratinocyte-specific C-type lectin-like receptor KACL with its high-affinity receptor NKp65
25150298 CLEC-2, unlike platelet ITAM receptors, is not regulated by proteolysis and can be used to monitor platelet-derived microparticles
20194751 Keratinocytes express KACL and are capable of stimulating NKp65-expressing cells in a KACL-dependent manner.
19630798 CLEC-2 is the receptor for podoplanin, a sialoglycoprotein implicated in tumor-induced platelet aggregation and tumor metastasis[review]
18976975 Knockdown of C-type lectin domain family 2, member A (CLEC2A) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18550855 T-cell PILAR signaling through CD161 supports CD3 antibody-dependent and antigen-specific T-cell proliferation by increasing the expression of antiapoptotic Bcl-xL and induces secretion of T helper type 1 cytokines

AA Sequence

MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSGDWLGVRDKCF      1 - 70
YFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNGWFEI     71 - 140
IGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL                                        141 - 174
//

Text Mined References (10)

PMID Year Title
26416420 2015 PDGF upregulates CLEC-2 to induce T regulatory cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25510854 2015 Key residues at the membrane-distal surface of KACL, but not glycosylation, determine the functional interaction of the keratinocyte-specific C-type lectin-like receptor KACL with its high-affinity receptor NKp65.
25150298 2014 CLEC-2 expression is maintained on activated platelets and on platelet microparticles.
23803857 2013 Structure of NKp65 bound to its keratinocyte ligand reveals basis for genetically linked recognition in natural killer gene complex.
20194751 2010 Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes.
19630798 2009 Novel interactions in platelet biology: CLEC-2/podoplanin and laminin/GPVI.
18550855 2008 PILAR is a novel modulator of human T-cell expansion.
18046548 2007 CLEC2A: a novel, alternatively spliced and skin-associated member of the NKC-encoded AICL-CD69-LLT1 family.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.