Property Summary

NCBI Gene PubMed Count 8
PubMed Score 339.25
PubTator Score 3.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 3.1e-48

Gene RIF (7)

AA Sequence

MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSGDWLGVRDKCF      1 - 70
YFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNGWFEI     71 - 140
IGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL                                        141 - 174
//

Text Mined References (10)

PMID Year Title