Property Summary

NCBI Gene PubMed Count 11
PubMed Score 21.48
PubTator Score 15.36

Knowledge Summary

Patent (661)

TINX Plot

  Disease Sources (4)

Disease Target Count
Pain 70
Disease Target Count P-value
non-small cell lung cancer 2798 2.31376824563736E-25
lung adenocarcinoma 2714 1.59973540611347E-19
ovarian cancer 8492 7.6051954337381E-11
cystic fibrosis 1670 2.63324798090049E-4
pituitary cancer 1972 0.00192413462629718
medulloblastoma, large-cell 6234 0.00351935285509227
atypical teratoid / rhabdoid tumor 4369 0.00398187792151125
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00830245441779755
group 4 medulloblastoma 1875 0.0138904889839752
glioblastoma 5572 0.0164250437759905
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0206941263831317
intraductal papillary-mucinous adenoma (IPMA) 2956 0.037894280937604
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cognitive disorder 44 0.0 1.0

Expression

Synonym

Accession Q6UVM3 Q3SY59 Q5VTN1 Q6ZMT3
Symbols SLICK
KCa4.2
SLO2.1

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid

 MGI Term (1)

Pathway (1)

Gene RIF (5)

PMID Text
26724206 Together these results suggest that hydrophobic interactions between residues in S5 and the C-terminal end of the pore helix stabilize Slo2.1 channels in a closed state.
25903137 Charge reversal of Asp757 of Slo2.1 prevented activation of channels by intracellular Na+, whereas activation by niflumic acid was unaffected.
25347289 Slick channels, in contrast to the similar Slack channels, are the only high-conductance K+ channels strongly sensitive to small changes in cell volume.
24166878 Together these findings suggest that (1) the selectivity filter and not the bundle crossing gates ion permeation and (2) dynamic coupling between the pore helix and the S5 and S6 segments mediates Slo2.1 channel activation.
14684870 Cloning and regulation of slick channel activity.

AA Sequence

MVDLESEVPPLPPRYRFRDLLLGDQGWQNDDRVQVEFYMNENTFKERLKLFFIKNQRSSLRIRLFNFSLK      1 - 70
LLSCLLYIIRVLLENPSQGNEWSHIFWVNRSLPLWGLQVSVALISLFETILLGYLSYKGNIWEQILRIPF     71 - 140
ILEIINAVPFIISIFWPSLRNLFVPVFLNCWLAKHALENMINDLHRAIQRTQSAMFNQVLILISTLLCLI    141 - 210
FTCICGIQHLERIGKKLNLFDSLYFCIVTFSTVGFGDVTPETWSSKLFVVAMICVALVVLPIQFEQLAYL    211 - 280
WMERQKSGGNYSRHRAQTEKHVVLCVSSLKIDLLMDFLNEFYAHPRLQDYYVVILCPTEMDVQVRRVLQI    281 - 350
PMWSQRVIYLQGSALKDQDLLRAKMDDAEACFILSSRCEVDRTSSDHQTILRAWAVKDFAPNCPLYVQIL    351 - 420
KPENKFHIKFADHVVCEEEFKYAMLALNCICPATSTLITLLVHTSRGQEGQQSPEQWQKMYGRCSGNEVY    421 - 490
HIVLEESTFFAEYEGKSFTYASFHAHKKFGVCLIGVRREDNKNILLNPGPRYIMNSTDICFYINITKEEN    491 - 560
SAFKNQDQQRKSNVSRSFYHGPSRLPVHSIIASMGTVAIDLQDTSCRSASGPTLSLPTEGSKEIRRPSIA    561 - 630
PVLEVADTSSIQTCDLLSDQSEDETTPDEEMSSNLEYAKGYPPYSPYIGSSPTFCHLLHEKVPFCCLRLD    631 - 700
KSCQHNYYEDAKAYGFKNKLIIVAAETAGNGLYNFIVPLRAYYRPKKELNPIVLLLDNPPDMHFLDAICW    701 - 770
FPMVYYMVGSIDNLDDLLRCGVTFAANMVVVDKESTMSAEEDYMADAKTIVNVQTLFRLFSSLSIITELT    771 - 840
HPANMRFMQFRAKDCYSLALSKLEKKERERGSNLAFMFRLPFAAGRVFSISMLDTLLYQSFVKDYMISIT    841 - 910
RLLLGLDTTPGSGFLCSMKITADDLWIRTYARLYQKLCSSTGDVPIGIYRTESQKLTTSESQISISVEEW    911 - 980
EDTKDSKEQGHHRSNHRNSTSSDQSDHPLLRRKSMQWARRLSRKGPKHSGKTAEKITQQRLNLYRRSERQ    981 - 1050
ELAELVKNRMKHLGLSTVGYDEMNDHQSTLSYILINPSPDTRIELNDVVYLIRPDPLAYLPNSEPSRRNS   1051 - 1120
ICNVTGQDSREETQL                                                          1121 - 1135
//

Text Mined References (16)

PMID Year Title
26724206 2016 Hydrophobic interactions between the S5 segment and the pore helix stabilizes the closed state of Slo2.1 potassium channels.
25903137 2015 Identification of the Intracellular Na+ Sensor in Slo2.1 Potassium Channels.
25347289 2014 Cell volume changes regulate slick (Slo2.1), but not slack (Slo2.2) K+ channels.
24166878 2013 Structural basis of ion permeation gating in Slo2.1 K+ channels.
23577725 2013 Genetic factors in nonsmokers with age-related macular degeneration revealed through genome-wide gene-environment interaction analysis.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16687497 2006 Opposite regulation of Slick and Slack K+ channels by neuromodulators.
More...