Property Summary

NCBI Gene PubMed Count 22
Grant Count 35
R01 Count 11
Funding $2,550,758.14
PubMed Score 147.86
PubTator Score 110.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (12)

PMID Text
26999736 expression of wild-type centriolar assembly protein SAS-6 in a SAS-6-depleted background resulted in centriole sizes that are similar to wild type.
26422590 SAS6 possesses an intrinsic microtubule assembly promoting activity and its outer exposed C-terminal tail may play critical roles in microtubule assembly and stabilizing microtubule attachment with the centriolar cartwheel.
26035073 Our present findings revealed that the upregulation of SASS6 expression is involved in the pathogenesis of CRC and is associated with a poor prognosis among patients with colon cancer.
24951542 A homozygous c.185T>C missense mutation in the HsSAS-6 gene is associated with the cause of autosomal recessive primary microcephaly.
24590172 HsSAS-6 homodimers are targeted to centrosomes where the local environment and high concentration of HsSAS-6 promote oligomerization, thus initiating procentriole formation.
23511974 Authors propose that CEP135 directly connects the central hub protein, hSAS-6, to the outer microtubules, and suggest that this interaction stabilizes the proper cartwheel structure for further CPAP-mediated centriole elongation.
22349698 STIL cooperates with SAS-6 and PLK4 in the control of centriole number and represents a key centriole duplication factor in human cells.
22020124 hSAS6 depletion hindered STIL targeting to the procentriole, implying that STIL and hSAS6 are mutually dependent for their centriolar localization.
21725316 The activity of SCF-FBXW5 is negatively regulated by Polo-like kinase 4 (PLK4), which phosphorylates FBXW5 at Ser 151 to suppress its ability to ubiquitylate HsSAS-6.
19503075 Data show that depletion of hSAS-6 specifically inhibits the formation of CPAP-induced PLSs derived from procentrioles.
More...

AA Sequence

MSQVLFHQLVPLQVKCKDCEERRVSIRMSIELQSVSNPVHRKDLVIRLTDDTDPFFLYNLVISEEDFQSL      1 - 70
KFQQGLLVDFLAFPQKFIDLLQQCTQEHAKEIPRFLLQLVSPAAILDNSPAFLNVVETNPFKHLTHLSLK     71 - 140
LLPGNDVEIKKFLAGCLKCSKEEKLSLMQSLDDATKQLDFTRKTLAEKKQELDKLRNEWASHTAALTNKH    141 - 210
SQELTNEKEKALQAQVQYQQQHEQQKKDLEILHQQNIHQLQNRLSELEAANKDLTERKYKGDSTIRELKA    211 - 280
KLSGVEEELQRTKQEVLSLRRENSTLDVECHEKEKHVNQLQTKVAVLEQEIKDKDQLVLRTKEAFDTIQE    281 - 350
QKVVLEENGEKNQVQLGKLEATIKSLSAELLKANEIIKKLQGDLKTLMGKLKLKNTVTIQQEKLLAEKEE    351 - 420
KLQKEQKELQDVGQSLRIKEQEVCKLQEQLEATVKKLEESKQLLKNNEKLITWLNKELNENQLVRKQDVL    421 - 490
GPSTTPPAHSSSNTIRSGISPNLNVVDGRLTYPTCGIGYPVSSAFAFQNTFPHSISAKNTSHPGSGTKVQ    491 - 560
FNLQFTKPNASLGDVQSGATISMPCSTDKENGENVGLESKYLKKREDSIPLRGLSQNLFSNSDHQRDGTL    561 - 630
GALHTSSKPTALPSASSAYFPGQLPNS                                               631 - 657
//

Text Mined References (31)

PMID Year Title
26999736 2016 SAS-6 engineering reveals interdependence between cartwheel and microtubules in determining centriole architecture.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26422590 2015 Human SAS-6 C-Terminus Nucleates and Promotes Microtubule Assembly in Vitro by Binding to Microtubules.
26035073 2015 SASS6 overexpression is associated with mitotic chromosomal abnormalities and a poor prognosis in patients with colorectal cancer.
24951542 2014 A missense mutation in the PISA domain of HsSAS-6 causes autosomal recessive primary microcephaly in a large consanguineous Pakistani family.
24590172 2014 Mechanisms of HsSAS-6 assembly promoting centriole formation in human cells.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
23511974 2013 Human microcephaly protein CEP135 binds to hSAS-6 and CPAP, and is required for centriole assembly.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22349705 2012 STIL is required for centriole duplication in human cells.
More...