Property Summary

NCBI Gene PubMed Count 22
Grant Count 9
R01 Count 5
Funding $633,343.28
PubMed Score 9.09
PubTator Score 12.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.211 0.002
chronic lymphosyte leukemia -1.100 0.000
astrocytoma 1.500 0.018
group 4 medulloblastoma 1.200 0.000
primary pancreatic ductal adenocarcinoma 1.170 0.013
lung cancer -1.700 0.001
ovarian cancer -2.000 0.000
pancreatic cancer 1.400 0.006

Gene RIF (12)

PMID Text
24264430 The CRTC3 polymorphism rs3862434 is associated with the plasma level of total cholesterol, and rs11635252 is associated with the risks of overweight and hypertriglyceridemia in a Chinese Han population.
24121173 Metaplastic Warthin tumor and metaplastic pleomorphic adenoma of salivary glands did not harbor CRTC1-MAML2 and CRTC3-MAML2 fusion transcripts, respectively, or MAML2 gene rearrangement.
21668476 mucoepidermoid carcinoma of the salivary glands positive for CRTC1-MAML2 or CRTC3-MAML2 fusion formed a favourable tumour subset that was distinct from fusion-negative cases
21536665 CRTC3 plays a selective role in mitochondrial biogenesis in response to rotenone
21164481 As a common human CRTC3 variant with increased transcriptional activity is associated with adiposity in two distinct Mexican-American cohorts, results suggest that adipocyte CRTC3 may play a role in the development of obesity in humans
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19749740 Mucoepidermoid carcinomas possessing CRTC3-MAML2 fusion may be associated with favorable clinicopathological features and patients may be younger than those with CRTC1-MAML2 fusion or those with no detectable gene fusion.
18187620 Knockdown of CREB regulated transcription coactivator 3 (CRTC3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18050304 study reports for the first time a CRTC3-MAML2 fusion gene in a mucoepidermoid carcinoma, as determined by RT-PCR and sequencing.
17644518 BCL3 functions as a repressor of HTLV-1 LTR-mediated transcription through interactions with TORC3
More...

AA Sequence

MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLR      1 - 70
SSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQ     71 - 140
PPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPG    141 - 210
PLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNL    211 - 280
HYSTPLPASLDTTDHHFGSMSVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHP    281 - 350
QTSVPNASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPT    351 - 420
SQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQG    421 - 490
SSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKD    491 - 560
LNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL               561 - 619
//

Text Mined References (38)

PMID Year Title
24264430 2014 CRTC3 polymorphisms were associated with the plasma level of total cholesterol and the risks of overweight and hypertriglyceridemia in a Chinese Han population.
24121173 2013 CRTC1-MAML2 and CRTC3-MAML2 fusions were not detected in metaplastic Warthin tumor and metaplastic pleomorphic adenoma of salivary glands.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23033494 2012 Phosphorylation of CRTC3 by the salt-inducible kinases controls the interconversion of classically activated and regulatory macrophages.
21668476 2011 Impact of CRTC1/3-MAML2 fusions on histological classification and prognosis of mucoepidermoid carcinoma.
21536665 2011 Role of cAMP-responsive element-binding protein (CREB)-regulated transcription coactivator 3 (CRTC3) in the initiation of mitochondrial biogenesis and stress response in liver cells.
21164481 2010 CRTC3 links catecholamine signalling to energy balance.
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...