Property Summary

NCBI Gene PubMed Count 23
PubMed Score 12.47
PubTator Score 12.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.500 1.8e-02
chronic lymphosyte leukemia -1.100 6.3e-09
group 4 medulloblastoma 1.200 1.2e-04
lung cancer -1.700 6.8e-04
osteosarcoma 1.211 2.3e-03
ovarian cancer -2.000 2.5e-08
pancreatic cancer 1.400 6.5e-03
primary pancreatic ductal adenocarcinoma 1.170 1.3e-02

Protein-protein Interaction (2)

Gene RIF (13)

AA Sequence

MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLR      1 - 70
SSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQ     71 - 140
PPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPG    141 - 210
PLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNL    211 - 280
HYSTPLPASLDTTDHHFGSMSVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHP    281 - 350
QTSVPNASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPT    351 - 420
SQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQG    421 - 490
SSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKD    491 - 560
LNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL               561 - 619
//

Text Mined References (40)

PMID Year Title