Property Summary

NCBI Gene PubMed Count 2
PubMed Score 55.00
PubTator Score 10.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
interstitial cystitis -1.300 0.000

AA Sequence

MGIVCAQCSFILLLSIIRARPPPFLFCPLSSQRTESPYKPVHLGLGPTDKVAAIAMARIIDLVPWDDGST      1 - 70
HVYASPAILLPMERQRNQLAGVKQQLYHPALPTLRHMDRDTVKACLPDEHCQSTTYCRKDEFDNAHFTLL     71 - 140
GVPNKPLQCLDITATGQKLRNRYHEGKLAPIAPGINRVDWPCFTRAIEDWSHFVSSAGEFKLPCLRKRAE    141 - 210
GLSGYAVRYLKPDVTQTWRYCLSQNPSLDRYGQKPLPFDSLNTFRSFGSSYSRVNYLTPWH             211 - 271
//

Text Mined References (4)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14652002 2003 TEPP, a new gene specifically expressed in testis, prostate, and placenta and well conserved in chordates.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.