Property Summary

NCBI Gene PubMed Count 2
Grant Count 2
Funding $102,750
PubMed Score 10.13
PubTator Score 2.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.000

Synonym

Accession Q6UQ28 Q6UQ24 Q6UQ25 Q6UQ27
Symbols C11orf34

Gene

 Grant Application (2)

Gene RIF (1)

PMID Text
18195351 Plet-1 will thus provide an invaluable tool for genetic analysis of the lineage relationships and molecular mechanisms operating in the development, homeostasis, and injury in several organ/tissue systems

AA Sequence

MAVFHDMLLQPLGMFLCLSLQLSSATFIRYSSTCFTFDEYYTITLDIKASSHIYESNAVYSVFVPVNDSV      1 - 70
YAVVMKTLDENSDSAGLWQRADKNCYSNSTYYVKDQYMTVLEAQWQAPEPENITEVEIQAFTVQIRALPI     71 - 140
LSTLKLREKLSTLALAAKIPQSSAFKPFFMITPKSIRLEGLANQVFSSPITEAIYILLAFLTSTLLF       141 - 207
//

Text Mined References (3)

PMID Year Title
18195351 2008 Identification of Plet-1 as a specific marker of early thymic epithelial progenitor cells.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15203209 2004 PLET1 (C11orf34), a highly expressed and processed novel gene in pig and mouse placenta, is transcribed but poorly spliced in human.