Property Summary

NCBI Gene PubMed Count 43
PubMed Score 155.92
PubTator Score 160.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.500 0.000
osteosarcoma -1.253 0.001
intraductal papillary-mucinous adenoma (... 1.300 0.005
intraductal papillary-mucinous carcinoma... 1.200 0.002
ovarian cancer 2.000 0.000

Synonym

Accession Q6UN15 B4DIR3 G3XAD6 Q0VGE0 Q499Y4 Q49AU3 Q7Z608 Q8WVN3 Q96F80 Q9H077 hFip1
Symbols Rhe
FIP1
hFip1

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG

 GO Function (1)

Gene RIF (25)

PMID Text
25761934 F604S exchange in FIP1L1-PDGFRA enhances FIP1L1-PDGFRA protein stability via SHP-2 and SRC and is associated with kinase inhibitor resistance in hypereosinophilic syndrome and chronic eosinophilic leukemia.
24763514 FIP1L1 differentially contributes to the pathogenesis of distinct types of leukemia.
24458279 FP fusion gene favors secondary KIT mutations in MCs via growth and proliferation signals or that a yet unknown mechanism causes genomic instability with independent evolution of FP and KIT D816V
23621172 Oncostatin M is a FIP1L1/PDGFRA-dependent mediator of cytokine production in chronic eosinophilic leukemia.
23125841 Tandem affinity purification and mass spectrometry analysis identify FIP1 like 1 protein (FIP1L1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22944561 description of polycythemia vera concurrent with FIP1L1-PDGFRA-positive myeloproliferative neoplasm with eosinophilia [case report]
22523564 results strongly suggest that JAK2 is activated by Fip1-like1 (FIP1L1)-platelet-derived growth factor receptor alpha (F/P) and is required for F/P stimulation of cellular proliferation and infiltration in chronic eosinophilic leukemia
22447844 Data show that the cyclin-dependent kinase 7/9 inhibitor (CDK7/9 inhibitor) potently inhibits FIP1L1-PDGFRalpha-positive Bcr-Abl-positive chronic myeloid leukemia (CML) cells.
21818111 Treatment with imatinib is associated with an excellent prognosis in FIP1L1-PDGFRA-positive chronic eosinophilic leukemia in first chronic phase
21399396 FIP1L1/PDGFRA fusion gene-positive myeloproliferative disorders with eosinophilia are discussed.
More...

AA Sequence

MSAGEVERLVSELSGGTGGDEEEEWLYGGPWDVHVHSDLAKDLDENEVERPEEENASANPPSGIEDETAE      1 - 70
NGVPKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNLNIKTGGRVYGTTGTKVKGVD     71 - 140
LDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLEVIPVTSTTNK    141 - 210
ITAEDCTMEVTPGAEIQDGRFNLFKVQQGRTGNSEKETALPSTKAEFTSPPSLFKTGLPPSRNSTSSQSQ    211 - 280
TSTASRKANSSVGKWQDRYGRAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVD    281 - 350
NNFSKPPPFFPPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRS    351 - 420
ARAFPYGNVAFPHLPGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRERDRDRDRERERTRERERERD    421 - 490
HSPTPSVFNSDEERYRYREYAERGYERHRASREKEERHRERRHREKEETRHKSSRSNSRRRHESEEGDSH    491 - 560
RRHKHKKSKRSKEGKEAGSEPAPEQESTEATPAE                                        561 - 594
//

Text Mined References (54)

PMID Year Title
25761934 2015 F604S exchange in FIP1L1-PDGFRA enhances FIP1L1-PDGFRA protein stability via SHP-2 and SRC: a novel mode of kinase inhibitor resistance.
25416956 2014 A proteome-scale map of the human interactome network.
25411163 2015 Identification of a variant in KDR associated with serum VEGFR2 and pharmacodynamics of Pazopanib.
24763514 2014 FIP1L1 presence in FIP1L1-RARA or FIP1L1-PDGFRA differentially contributes to the pathogenesis of distinct types of leukemia.
24458279 2014 The FIP1L1-PDGFRA fusion gene and the KIT D816V mutation are coexisting in a small subset of myeloid/lymphoid neoplasms with eosinophilia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
23621172 2013 Oncostatin M is a FIP1L1/PDGFRA-dependent mediator of cytokine production in chronic eosinophilic leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22944561 2012 Case of polycythemia vera concurrent with FIP1L1-PDGFRA-positive myeloproliferative neoplasm with eosinophilia.
More...