Property Summary

NCBI Gene PubMed Count 45
PubMed Score 159.75
PubTator Score 160.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.300 5.0e-03
intraductal papillary-mucinous carcinoma... 1.200 2.4e-03
osteosarcoma -1.253 5.5e-04
ovarian cancer 2.000 6.2e-06
psoriasis -1.500 7.2e-05

 GO Function (1)

Gene RIF (26)

AA Sequence

MSAGEVERLVSELSGGTGGDEEEEWLYGGPWDVHVHSDLAKDLDENEVERPEEENASANPPSGIEDETAE      1 - 70
NGVPKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNLNIKTGGRVYGTTGTKVKGVD     71 - 140
LDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLEVIPVTSTTNK    141 - 210
ITAEDCTMEVTPGAEIQDGRFNLFKVQQGRTGNSEKETALPSTKAEFTSPPSLFKTGLPPSRNSTSSQSQ    211 - 280
TSTASRKANSSVGKWQDRYGRAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVD    281 - 350
NNFSKPPPFFPPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRS    351 - 420
ARAFPYGNVAFPHLPGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRERDRDRDRERERTRERERERD    421 - 490
HSPTPSVFNSDEERYRYREYAERGYERHRASREKEERHRERRHREKEETRHKSSRSNSRRRHESEEGDSH    491 - 560
RRHKHKKSKRSKEGKEAGSEPAPEQESTEATPAE                                        561 - 594
//

Text Mined References (56)

PMID Year Title