Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.20
PubTator Score 0.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Azoospermia 89 3.109 1.6

AA Sequence

MEALPPVRSSLLGILLQVTRLSVLLVQNRDHLYNFLLLKINLFNHWVSGLAQEARGSCNWQAHLPLGAAA      1 - 70
CPLGQALWAGLALIQVPVWLVLQGPRLMWAGMWGSTKGLGLALLSAWEQLGLSVAIWTDLFLSCLHGLML     71 - 140
VALLLVVVTWRVCQKSHCFRLGRQLSKALQVNCVVRKLLVQLRRLYWWVETMTALTSWHLAYLITWTTCL    141 - 210
ASHLLQAAFEHTTQLAEAQEVEPQEVSGSSLLPSLSASSDSESGTVLPEQETPRE                   211 - 265
//

Text Mined References (5)

PMID Year Title
18398435 2008 Williams-Beuren syndrome TRIM50 encodes an E3 ubiquitin ligase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8812460 1996 Identification of genes from a 500-kb region at 7q11.23 that is commonly deleted in Williams syndrome patients.