Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.88
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 9.4e-03

Gene RIF (1)

AA Sequence

MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFV      1 - 70
FSGCNGNLNNFKLKIEREVACVAKYKPPR                                              71 - 99
//

Text Mined References (4)

PMID Year Title