Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.88
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Gene RIF (1)

PMID Text
21536719 We propose that the evolution of WFDC8 and SPINT4 has been shaped by complex selective scenarios due to the interdependence of variant fitness and ecological variables.

AA Sequence

MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFV      1 - 70
FSGCNGNLNNFKLKIEREVACVAKYKPPR                                              71 - 99
//

Text Mined References (4)

PMID Year Title
21988899 2011 Three genes expressing Kunitz domains in the epididymis are related to genes of WFDC-type protease inhibitors and semen coagulum proteins in spite of lacking similarity between their protein products.
21536719 2011 Differing evolutionary histories of WFDC8 (short-term balancing) in Europeans and SPINT4 (incomplete selective sweep) in Africans.
18390568 2008 Transcriptome analysis of a cDNA library from adult human epididymis.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.