Property Summary

NCBI Gene PubMed Count 34
PubMed Score 40.21
PubTator Score 22.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.593 2.6e-03
active ulcerative colitis 1.152 2.2e-02
atypical teratoid / rhabdoid tumor 1.400 2.7e-04
gastric carcinoma 1.800 4.5e-02
glioblastoma 1.200 4.4e-03
lung adenocarcinoma 1.200 3.1e-11
nasopharyngeal carcinoma 1.200 5.8e-04
ovarian cancer 2.200 8.7e-04
Polycystic ovary syndrome -1.040 1.3e-02
primary Sjogren syndrome 1.300 4.1e-04
psoriasis 1.100 5.1e-09

Protein-protein Interaction (5)

Gene RIF (26)

AA Sequence

MGTRLPLVLRQLRRPPQPPGPPRRLRVPCRASSGGGGGGGGGREGLLGQRRPQDGQARSSCSPGGRTPAA      1 - 70
RDSIVREVIQNSKEVLSLLQEKNPAFKPVLAIIQAGDDNLMQEINQNLAEEAGLNITHICLPPDSSEAEI     71 - 140
IDEILKINEDTRVHGLALQISENLFSNKVLNALKPEKDVDGVTDINLGKLVRGDAHECFVSPVAKAVIEL    141 - 210
LEKSGVNLDGKKILVVGAHGSLEAALQCLFQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLT    211 - 280
WIQPGTTVLNCSHDFLSGKVGCGSPRIHFGGLIEEDDVILLAAALRIQNMVSSGRRWLREQQHRRWRLHC    281 - 350
LKLQPLSPVPSDIEISRGQTPKAVDVLAKEIGLLADEIEIYGKSKAKVRLSVLERLKDQADGKYVLVAGI    351 - 420
TPTPLGEGKSTVTIGLVQALTAHLNVNSFACLRQPSQGPTFGVKGGAAGGGYAQVIPMEEFNLHLTGDIH    421 - 490
AITAANNLLAAAIDTRILHENTQTDKALYNRLVPLVNGVREFSEIQLARLKKLGINKTDPSTLTEEEVSK    491 - 560
FARLDIDPSTITWQRVLDTNDRFLRKITIGQGNTEKGHYRQAQFDIAVASEIMAVLALTDSLADMKARLG    561 - 630
RMVVASDKSGQPVTADDLGVTGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALK    631 - 700
LVGEEGFVVTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEEN    701 - 770
IQLVADGCCNLQKQIQITQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVD    771 - 840
LARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQGFGNLPICMAKT    841 - 910
HLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYDIDLDTETEQVKGLF      911 - 978
//

Text Mined References (43)

PMID Year Title