Property Summary

NCBI Gene PubMed Count 21
PubMed Score 0.00
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Beckwith-Wiedemann syndrome 44 3.133 1.6
Disease Target Count
Common variable immunodeficiency 101

Synonym

Accession Q6U949 A5PKV8 A6NNQ2 Q7Z712 Q9P2W0
Symbols PEG8
IGF2AS
IGF2-AS1

Gene

 Compartment GO Term (0)

Gene RIF (14)

AA Sequence

MSKRKWRGFRGAQQERAQPPAASPQPCPAPHAGLPGGSRRRAPAPAGQQQMRAESRSGAQRRRGSARRGA      1 - 70
HREAGGCVRGRTRSSGSERSNALWQAVDAAEALALSSPLRRPWDQAQHFTNPAPFSKGPQSAPPSPPAGR     71 - 140
RRRGADLALTPLAGEGHTRWRQPGRPGK                                              141 - 168
//

Text Mined References (23)

PMID Year Title