Property Summary

NCBI Gene PubMed Count 21
PubMed Score 0.00
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q6U949 A5PKV8 A6NNQ2 Q7Z712 Q9P2W0
Symbols PEG8
IGF2AS
IGF2-AS1

Gene

 Compartment GO Term (0)

Gene RIF (14)

PMID Text
24824313 Germline variations in IGF2-AS gene were associated with prostate cancer mortality, independent of stage and Gleason score and specific to prostate cancer.
23193016 The strongest evidence for altered methylation patterns in shiftworkers was observed for IGF2AS gene.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19767753 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSKRKWRGFRGAQQERAQPPAASPQPCPAPHAGLPGGSRRRAPAPAGQQQMRAESRSGAQRRRGSARRGA      1 - 70
HREAGGCVRGRTRSSGSERSNALWQAVDAAEALALSSPLRRPWDQAQHFTNPAPFSKGPQSAPPSPPAGR     71 - 140
RRRGADLALTPLAGEGHTRWRQPGRPGK                                              141 - 168
//

Text Mined References (23)

PMID Year Title
24824313 2014 Insulin-like growth factor pathway genetic polymorphisms, circulating IGF1 and IGFBP3, and prostate cancer survival.
23193016 2013 Methylation alterations at imprinted genes detected among long-term shiftworkers.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20564319 2010 Prostate cancer risk-associated variants reported from genome-wide association studies: meta-analysis and their contribution to genetic Variation.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19767753 2009 Identification of seven new prostate cancer susceptibility loci through a genome-wide association study.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
More...