Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 6.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Basal cell carcinoma 29

Gene RIF (4)

PMID Text
22634725 Crystallographic determination of 14-3-3-sigma binding sites in the human peptidylarginine deiminase type VI.
18849993 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15625577 Cloning, gene organization and expression of peptidylarginine deiminase type 6.
15087120 This study is the first description of the human PADI6 gene and encoded protein, and the first step towards a better understanding of the coordinated regulation of PADI gene expression.

AA Sequence

MVSVEGRAMSFQSIIHLSLDSPVHAVCVLGTEICLDLSGCAPQKCQCFTIHGSGRVLIDVANTVISEKED      1 - 70
ATIWWPLSDPTYATVKMTSPSPSVDADKVSVTYYGPNEDAPVGTAVLYLTGIEVSLEVDIYRNGQVEMSS     71 - 140
DKQAKKKWIWGPSGWGAILLVNCNPADVGQQLEDKKTKKVIFSEEITNLSQMTLNVQGPSCILKKYRLVL    141 - 210
HTSKEESKKARVYWPQKDNSSTFELVLGPDQHAYTLALLGNHLKETFYVEAIAFPSAEFSGLISYSVSLV    211 - 280
EESQDPSIPETVLYKDTVVFRVAPCVFIPCTQVPLEVYLCRELQLQGFVDTVTKLSEKSNSQVASVYEDP    281 - 350
NRLGRWLQDEMAFCYTQAPHKTTSLILDTPQAADLDEFPMKYSLSPGIGYMIQDTEDHKVASMDSIGNLM    351 - 420
VSPPVKVQGKEYPLGRVLIGSSFYPSAEGRAMSKTLRDFLYAQQVQAPVELYSDWLMTGHVDEFMCFIPT    421 - 490
DDKNEGKKGFLLLLASPSACYKLFREKQKEGYGDALLFDELRADQLLSNGREAKTIDQLLADESLKKQNE    491 - 560
YVEKCIHLNRDILKTELGLVEQDIIEIPQLFCLEKLTNIPSDQQPKRSFARPYFPDLLRMIVMGKNLGIP    561 - 630
KPFGPQIKGTCCLEEKICCLLEPLGFKCTFINDFDCYLTEVGDICACANIRRVPFAFKWWKMVP          631 - 694
//

Text Mined References (8)

PMID Year Title
24403052 2014 Germline sequence variants in TGM3 and RGS22 confer risk of basal cell carcinoma.
23164236 2012 Polymorphisms in peptidylarginine deiminase associate with rheumatoid arthritis in diverse Asian populations: evidence from MyEIRA study and meta-analysis.
22634725 2012 Identification and structural characterization of two 14-3-3 binding sites in the human peptidylarginine deiminase type VI.
22364592 2012 Myocardial citrullination in rheumatoid arthritis: a correlative histopathologic study.
18849993 2008 Common variants on 1p36 and 1q42 are associated with cutaneous basal cell carcinoma but not with melanoma or pigmentation traits.
15625577 2004 cDNA cloning, gene organization and expression analysis of human peptidylarginine deiminase type VI.
15087120 2004 Comparative analysis of the mouse and human peptidylarginine deiminase gene clusters reveals highly conserved non-coding segments and a new human gene, PADI6.
14579251 2003 PAD, a growing family of citrullinating enzymes: genes, features and involvement in disease.