Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.16
PubTator Score 3.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
aldosterone-producing adenoma -1.474 1.0e-02
astrocytic glioma 1.300 1.5e-02
Breast cancer 2.300 2.5e-02
cystic fibrosis 1.738 6.9e-04
ependymoma 1.400 2.8e-03
group 4 medulloblastoma 1.400 1.2e-02
hepatocellular carcinoma -1.100 8.9e-05
intraductal papillary-mucinous adenoma (... 1.300 8.1e-04
intraductal papillary-mucinous carcinoma... 1.600 4.6e-03
intraductal papillary-mucinous neoplasm ... 1.200 7.0e-03
invasive ductal carcinoma -1.100 1.1e-02
limb girdle muscular dystrophy 2A -1.044 1.2e-03
medulloblastoma, large-cell 1.300 1.2e-03
Multiple myeloma 1.152 3.9e-02
oligodendroglioma 1.500 1.3e-03
osteosarcoma 1.303 5.7e-04
ovarian cancer 1.100 3.8e-03
pancreatic ductal adenocarcinoma liver m... 1.399 8.1e-03
Pick disease 1.100 6.0e-05
pituitary cancer -1.300 5.8e-06
psoriasis -2.300 4.5e-03
spina bifida -1.802 4.3e-02
tuberculosis -1.100 5.0e-05
ulcerative colitis -1.300 6.5e-04

Gene RIF (5)

AA Sequence

MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFRDSRLFTDVII      1 - 70
CVEGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECFLQYVYTGKVKITTENVQYLF     71 - 140
ETSSLFQISVLRDACAKFLEEQLDPCNCLGIQRFADTHSLKTLFTKCKNFALQTFEDVSQHEEFLELDKD    141 - 210
ELIDYICSDELVIGKEEMVFEAVMRWVYRAVDLRRPLLHELLTHVRLPLLHPNYFVQTVEVDQLIQNSPE    211 - 280
CYQLLHEARRYHILGNEMMSPRTRPRRSTGYSEVIVVVGGCERVGGFNLPYTECYDPVTGEWKSLAKLPE    281 - 350
FTKSEYAVCALRNDILVSGGRINSRDVWIYNSQLNIWIRVASLNKGRWRHKMAVLLGKVYVVGGYDGQNR    351 - 420
LSSVECYDSFSNRWTEVAPLKEAVSSPAVTSCVGKLFVIGGGPDDNTCSDKVQSYDPETNSWLLRAAIPI    421 - 490
AKRCITAVSLNNLIYVAGGLTKAIYCYDPVEDYWMHVQNTFSRQENCGMSVCNGKIYILGGRRENGEATD    491 - 560
TILCYDPATSIITGVAAMPRPVSYHGCVTIHRYNEKCFKL                                  561 - 600
//

Text Mined References (12)

PMID Year Title