Property Summary

NCBI Gene PubMed Count 6
Grant Count 9
R01 Count 6
Funding $536,137.67
PubMed Score 8.77
PubTator Score 3.91

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
23512275 Data show that a miRNA, hsv1-mir-H27, encoded within the genome of herpes simplex virus 1 (HSV-1), targets the mRNA of the cellular transcriptional repressor Kelch-like 24 (KLHL24).
18692513 KRIP6 regulates kainate receptors by inhibiting PICK1 modulation via competition or a mutual blocking effect

AA Sequence

MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFRDSRLFTDVII      1 - 70
CVEGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECFLQYVYTGKVKITTENVQYLF     71 - 140
ETSSLFQISVLRDACAKFLEEQLDPCNCLGIQRFADTHSLKTLFTKCKNFALQTFEDVSQHEEFLELDKD    141 - 210
ELIDYICSDELVIGKEEMVFEAVMRWVYRAVDLRRPLLHELLTHVRLPLLHPNYFVQTVEVDQLIQNSPE    211 - 280
CYQLLHEARRYHILGNEMMSPRTRPRRSTGYSEVIVVVGGCERVGGFNLPYTECYDPVTGEWKSLAKLPE    281 - 350
FTKSEYAVCALRNDILVSGGRINSRDVWIYNSQLNIWIRVASLNKGRWRHKMAVLLGKVYVVGGYDGQNR    351 - 420
LSSVECYDSFSNRWTEVAPLKEAVSSPAVTSCVGKLFVIGGGPDDNTCSDKVQSYDPETNSWLLRAAIPI    421 - 490
AKRCITAVSLNNLIYVAGGLTKAIYCYDPVEDYWMHVQNTFSRQENCGMSVCNGKIYILGGRRENGEATD    491 - 560
TILCYDPATSIITGVAAMPRPVSYHGCVTIHRYNEKCFKL                                  561 - 600
//

Text Mined References (8)

PMID Year Title
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23512275 2013 A microRNA encoded by HSV-1 inhibits a cellular transcriptional repressor of viral immediate early and early genes.
18692513 2008 The BTB/kelch protein, KRIP6, modulates the interaction of PICK1 with GluR6 kainate receptors.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17254796 2007 KRIP6: a novel BTB/kelch protein regulating function of kainate receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.