Property Summary

NCBI Gene PubMed Count 8
PubMed Score 14.52
PubTator Score 6.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Lung Neoplasms 171
Disease Target Count P-value
psoriasis 6685 1.19726379587126E-26
posterior fossa group B ependymoma 1530 7.5898147316485E-16
lung adenocarcinoma 2714 6.67791960078384E-8
osteosarcoma 7933 2.79970138558584E-7
nasopharyngeal carcinoma 1056 3.65525619031267E-7
Endometriosis 535 0.0156944061614666
Disease Target Count Z-score Confidence
Lung adenoma 8 6.259 3.1
Inferior myocardial infarction 4 3.66 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.512 0.000
posterior fossa group B ependymoma 4.000 0.000
lung adenocarcinoma -1.100 0.000
nasopharyngeal carcinoma -2.800 0.000
Endometriosis -1.113 0.016
psoriasis -1.400 0.000

Synonym

Accession Q6TDU7 B4DNP2 F5H6T6 Q17RL2 Q4G171 Q5U5K5 Q9NV50
Symbols LAS1
PPP1R54

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (4)

PMID Text
20734064 Observational study of gene-disease association. (HuGE Navigator)
20639392 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18299280 Observational study of gene-disease association. (HuGE Navigator)
16410263 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGSKKKKVTKAERLKLLQEEEERRLKEEEEARLKYEKEEMERLEIQRIEKEKWHRLEAKDLERRNEELE      1 - 70
ELYLLERCFPEAEKLKQETKLLSQWKHYIQCDGSPDPSVAQEMNTFISLWKEKTNETFEEVIEKSKVVLN     71 - 140
LIEKLKFILLETPPCDLQDKNIIQYQESILQLQELLHLKFGVATEILLKQASTLADLDSGNMEKVIKDEN    141 - 210
VTLYVWANLKKNPRHRSVRFSETQIGFEIPRILATSDIAVRLLHTHYDHVSALHPVSTPSKEYTSAVTEL    211 - 280
VKDDVKNVEKAISKEVEEESKQQERGSHLIQEEEIKVEEEQGDIEVKMSSAEEESEAIKCEREMKVLSET    281 - 350
VSAAQLLLVENSSEKPDFFEDNVVDLCQFTTLGGVYHLDILELPPQCKPVKGWMIVEILKEGLQKYTYPP    351 - 420
ETTEEFETENAFPPIEVTLEVHENVIFFEDPVVVRWDAEGKHWRTDGISNVSYKPKERLVTFSLDTFGPV    421 - 490
TLIQDAHINMPYQSWELRPLDVNKVLLTVTTVFTEIQIQIKENLCMLSSIKLKDKKHISILEGTWMTPIP    491 - 560
FIIALKEAGLNIFPTRHSHFYVIINNKVPLVEVKAYRQMALLSSAFAFGWSKWNLLCNSTKVVFKVREHL    561 - 630
TEACTENPNWALLMFSGDRAQRLKIKEESEAFSEALKEETEFHSTLYHMVKDFASEEAMEKVRSSNCQFV    631 - 700
NSVCHMLLSTRLLSYS                                                          701 - 716
//

Text Mined References (11)

PMID Year Title
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20639392 2010 Genome-wide association analysis identifies multiple loci related to resting heart rate.
18299280 2008 Association of KRAS polymorphisms with risk for lung adenocarcinoma accompanied by atypical adenomatous hyperplasias.
16541075 2006 The finished DNA sequence of human chromosome 12.
16410263 2006 A V141L polymorphism of the human LRMP gene is associated with survival of lung cancer patients.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14583591 2003 Positional cloning of the major quantitative trait locus underlying lung tumor susceptibility in mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...