Property Summary

NCBI Gene PubMed Count 29
PubMed Score 27.63
PubTator Score 14.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4740 1.5e-04
active Crohn's disease 922 3.6e-02

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease 1.238 3.6e-02
lung cancer 2.000 1.5e-04

 GO Function (1)

Gene RIF (22)

AA Sequence

MHQKLLKSAHYIELGSYQYWPVLVPRGIRLYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKSLFILSNET      1 - 70
VNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRW     71 - 140
MALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQRLRSIIFCSV    141 - 210
SGYGVIPTLHWVWLNGGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHIL    211 - 280
AVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL                                           281 - 311
//

Text Mined References (29)

PMID Year Title