Property Summary

NCBI Gene PubMed Count 22
Grant Count 4
R01 Count 4
Funding $831,862
PubMed Score 19.40
PubTator Score 14.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
active Crohn's disease 918
lung cancer 4,466

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 2.000 0.000
active Crohn's disease 1.238 0.036

Synonym

Accession Q6TCH7 A8K5B7 B3KP59 Q6PIQ1 Q86X05 Q8NCP9
Symbols RKTG

Gene

PANTHER Protein Class (1)

 GO Function (1)

Gene RIF (16)

PMID Text
26905590 findings not only pinpoint that Twist1 mediates the modulatory function of PAQR3 on EMT and metastasis but also suggest that targeting Twist1 is a promising strategy to control metastasis of tumors with downregulation of PAQR3
26327583 A novel role for the newly characterized, Golgi-localized PAQR3 in regulating heterotrimeric G-proteins at the non-canonical subcellular location of the Golgi.
26311497 PAQR3 regulates cholesterol homeostasis by anchoring Scap/SREBP to the Golgi and disruption of such function reduces cholesterol biosynthesis.
26205499 DDB2 is involved in ubiquitination and degradation of PAQR3 in gastric cancer cells.
25900239 Our data indicate that PAQR3 functions as a tumor suppressor in the development of human breast cancers.
25706881 PAQR3 (progestin and adipoQ receptors member 3), a tumour suppressor specifically localized in the Golgi apparatus, negatively regulates H3K4 trimethylation (H3K4me3).
25510670 PAQR3 might act as a tumor suppressor in osteosarcoma.
25330156 MicroRNA-137 upregulation increases bladder cancer cell proliferation and invasion by targeting PAQR3
25310770 PAQR3 may play an important role in the progression of hepatocellular carcinoma and serve as a potential candidate for the targeted therapy of hepatocellular carcinoma
24799462 PAQR3 is markedly down-regulated in human gastric cancers. PAQR3 expression level is closely associated with the progression and metastasis of gastric cancers
More...

AA Sequence

MHQKLLKSAHYIELGSYQYWPVLVPRGIRLYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKSLFILSNET      1 - 70
VNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRW     71 - 140
MALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQRLRSIIFCSV    141 - 210
SGYGVIPTLHWVWLNGGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHIL    211 - 280
AVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL                                           281 - 311
//

Text Mined References (22)

PMID Year Title
26905590 2016 PAQR3 enhances Twist1 degradation to suppress epithelial-mesenchymal transition and metastasis of gastric cancer cells.
26327583 2015 PAQR3 regulates Golgi vesicle fission and transport via the G??-PKD signaling pathway.
26311497 2015 PAQR3 modulates cholesterol homeostasis by anchoring Scap/SREBP complex to the Golgi apparatus.
26205499 2015 DDB2 is involved in ubiquitination and degradation of PAQR3 and regulates tumorigenesis of gastric cancer cells.
25900239 2015 PAQR3 expression is downregulated in human breast cancers and correlated with HER2 expression.
25706881 2015 PAQR3 modulates H3K4 trimethylation by spatial modulation of the regulatory subunits of COMPASS-like complexes in mammalian cells.
25510670 2015 The tumor suppressor role of PAQR3 in osteosarcoma.
25330156 2014 MicroRNA-137 upregulation increases bladder cancer cell proliferation and invasion by targeting PAQR3.
25310770 2014 Identification of PAQR3 as a new candidate tumor suppressor in hepatocellular carcinoma.
24799462 2014 A Golgi-specific protein PAQR3 is closely associated with the progression, metastasis and prognosis of human gastric cancers.
More...