Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $273,230
PubMed Score 4.05
PubTator Score 2.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.142 0.000
glioblastoma -1.900 0.044
group 3 medulloblastoma -3.800 0.000
atypical teratoid/rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -1.600 0.016
lung cancer -1.200 0.003
fibroadenoma 1.300 0.019
pediatric high grade glioma -1.900 0.000
pilocytic astrocytoma -1.700 0.000
subependymal giant cell astrocytoma -2.944 0.013
ductal carcinoma in situ 1.100 0.012

Gene RIF (2)

PMID Text
23161870 The results suggest that PAQR6 and PAQR9 (mPRdelta and mPRepsilon) function as mPRs coupled to G proteins and are potential intermediaries of nonclassical antiapoptotic actions of neurosteroids in the central nervous system.
18603275 PAQR6 is a previously uncharacterized PAQR which is also capable of responding to progesterone.

AA Sequence

MLSLKLPQLLQVHQVPRVFWEDGIMSGYRRPTSSALDCVLSSFQMTNETVNIWTHFLPTWYFLWRLLALA      1 - 70
GGPGFRAEPYHWPLLVFLLPACLYPFASCCAHTFSSMSPRMRHICYFLDYGALSLYSLGCAFPYAAYSMP     71 - 140
ASWLHGHLHQFFVPAAALNSFLCTGLSCYSRFLELESPGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGR    141 - 210
GHGCGQEALSTSHGYHLFCALLTGFLFASHLPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMG    211 - 280
SRRAWLATQEPALGLAGTVATLVLAAAGNLLIIAAFTATLLRAPSTCPLLQGGPLEGGTQAKQQ          281 - 344
//

Text Mined References (12)

PMID Year Title
23161870 2013 Characterization, neurosteroid binding and brain distribution of human membrane progesterone receptors ? and {epsilon} (mPR? and mPR{epsilon}) and mPR? involvement in neurosteroid inhibition of apoptosis.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
18603275 2008 Heterologous expression of human mPRalpha, mPRbeta and mPRgamma in yeast confirms their ability to function as membrane progesterone receptors.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16044242 2005 PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...