Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.05
PubTator Score 2.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 1.6e-02
Astrocytoma, Pilocytic -1.700 1.5e-05
atypical teratoid / rhabdoid tumor -1.700 1.5e-03
ductal carcinoma in situ 1.100 1.2e-02
fibroadenoma 1.300 1.9e-02
glioblastoma -1.400 3.8e-04
group 3 medulloblastoma -3.800 5.1e-06
lung cancer -1.200 3.2e-03
medulloblastoma, large-cell -3.100 2.2e-07
osteosarcoma -1.142 3.0e-04
primitive neuroectodermal tumor -1.600 1.6e-02
subependymal giant cell astrocytoma -2.944 1.3e-02

Gene RIF (2)

AA Sequence

MLSLKLPQLLQVHQVPRVFWEDGIMSGYRRPTSSALDCVLSSFQMTNETVNIWTHFLPTWYFLWRLLALA      1 - 70
GGPGFRAEPYHWPLLVFLLPACLYPFASCCAHTFSSMSPRMRHICYFLDYGALSLYSLGCAFPYAAYSMP     71 - 140
ASWLHGHLHQFFVPAAALNSFLCTGLSCYSRFLELESPGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGR    141 - 210
GHGCGQEALSTSHGYHLFCALLTGFLFASHLPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMG    211 - 280
SRRAWLATQEPALGLAGTVATLVLAAAGNLLIIAAFTATLLRAPSTCPLLQGGPLEGGTQAKQQ          281 - 344
//

Text Mined References (13)

PMID Year Title