Property Summary

NCBI Gene PubMed Count 29
PubMed Score 68.21
PubTator Score 50.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 3.0
Disease Target Count Z-score Confidence
Duodenal obstruction 8 3.498 1.7
Epidermolysis bullosa dystrophica 6 3.398 1.7
Disease Target Count
Cataract 40 1
Nephroblastoma 51

Expression

  Differential Expression (16)

Disease log2 FC p
Breast cancer -1.300 6.9e-04
atypical teratoid / rhabdoid tumor -1.200 2.1e-02
chronic rhinosinusitis -1.303 5.0e-04
cystic fibrosis 1.114 3.1e-03
ependymoma 2.000 9.6e-06
group 3 medulloblastoma -1.100 3.8e-02
Hydrolethalus syndrome 1.257 4.8e-02
interstitial cystitis -1.100 2.4e-03
intraductal papillary-mucinous adenoma (... 1.300 4.8e-02
intraductal papillary-mucinous neoplasm ... 3.300 1.8e-03
medulloblastoma, large-cell -1.300 7.3e-03
non-small cell lung cancer 1.404 1.5e-11
ovarian cancer -1.300 1.3e-03
pancreatic cancer 1.600 2.8e-05
subependymal giant cell astrocytoma 2.157 1.0e-02
tuberculosis 1.600 5.6e-06

Gene RIF (18)

AA Sequence

MPFAKRIVEPQWLCRQRRPAPGPAVDASGGSAEPPPPLQPPGRRDLDEVEAPGPEEPARAVPAPSGLPPP      1 - 70
PPPLPAPADQTQPPHGEASVAGEESTAGIPEAAPAAGEASSAAAAAAVLLMLDLCAVSNAALARVLRQLS     71 - 140
DVARHACSLFQELESDIQLTHRRVWALQGKLGGVQRVLSTLDPKQEAVPVSNLDIESKLSVYYRAPWHQQ    141 - 210
RNIFLPATRPPCVEELHRHARQSLQALRREHRSRSDRREQRAAAPLSIAAPPLPAYPPAHSQRRREFKDR    211 - 280
HFLTFNSTRSPSPTECCHMTPWSRKSHPPEDEDTDVMLGQRPKNPIHNIPSTLDKQTNWSKALPLPTPEE    281 - 350
KMKQDAQVISSCIIPINVTGVGFDREASIRCSLVHSQSVLQRRRKLRRRKTISGIPRRVQQEIDSDESPV    351 - 420
ARERNVIVHTNPDPSNTVNRISGTRDSECQTEDILIAAPSRRRIRAQRGQSIAASLSHSAGNISALADKG    421 - 490
DTMFTPAVSSRTRSRSLPREGNRGGDAEPKVGAKPSAYEEGESFVGDHERTPNDFSEAPSSPSAQDHQPT    491 - 560
LGLACSQHLHSPQHKLSERGRSRLSRMAADSGSCDISSNSDTFGSPIHCISTAGVLLSSHMDQKDDHQSS    561 - 630
SGNWSGSSSTCPSQTSETIPPAASPPLTGSSHCDSELSLNTAPHANEDASVFVTEQYNDHLDKVRGHRAN    631 - 700
SFTSTVADLLDDPNNSNTSDSEWNYLHHHHDASCRQDFSPERPKADSLGCPSFTSMATYDSFLEKSPSDK    701 - 770
ADTSSHFSVDTEGYYTSMHFDCGLKGNKSYVCHYAALGPENGQGVGASPGLPDCAWQDYLDHKRQGRPSI    771 - 840
SFRKPKAKPTPPKRSSSLRKSDGNADISEKKEPKISSGQHLPHSSREMKLPLDFANTPSRMENANLPTKQ    841 - 910
EPSWINQSEQGIKEPQLDASDIPPFKDEVAESTHYADLWLLNDLKTNDPYRSLSNSSTATGTTVIECIKS    911 - 980
PESSESQTSQSESRATTPSLPSVDNEFKLASPEKLAGLASPSSGYSSQSETPTSSFPTAFFSGPLSPGGS    981 - 1050
KRKPKVPERKSSLQQPSLKDGTISLSKDLELPIIPPTHLDLSALHNVLNKPFHHRHPLHVFTHNKQNTVG   1051 - 1120
ETLRSNPPPSLAITPTILKSVNLRSINKSEEVKQKEENNTDLPYLEESTLTTAALSPSKIRPHTANKSVS   1121 - 1190
RQYSTEDTILSFLDSSAVEMGPDKLHLEKNSTFDVKNRCDPETITSAGSSLLDSNVTKDQVRTETEPIPE   1191 - 1260
NTPTKNCAFPTEGFQRVSAARPNDLDGKIIQYGPGPDETLEQVQKAPSAGLEEVAQPESVDVITSQSDSP   1261 - 1330
TRATDVSNQFKHQFVMSRHHDKVPGTISYESEITSVNSFPEKCSKQENIASGISAKSASDNSKAEETQGN   1331 - 1400
VDEASLKESSPSDDSIISPLSEDSQAEAEGVFVSPNKPRTTEDLFAVIHRSKRKVLGRKDSGDMSVRSKS   1401 - 1470
RAPLSSSSSSASSITSPSSNVTTPNSQRSPGLIYRNAKKSNTSNEEFKLLLLKKGSRSDSSYRMSATEIL   1471 - 1540
KSPILPKPPGELTAESPQSTDDAHQGSQGAEALSPLSPCSPRVNAEGFSSKSFATSASARVGRSRAPPAA   1541 - 1610
SSSRYSVRCRLYNTPMQAISEGETENSDGSPHDDRSSQSST                                1611 - 1651
//

Text Mined References (36)

PMID Year Title