Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.42
PubTator Score 0.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MRPTWKALSHPAWPEEKNKQILVLGLDGAGKTSVLHSLASNRVQHSVAPTQGFHAVCINTEDSQMEFLEI      1 - 70
GGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIH     71 - 140
EALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ                           141 - 187
//

Text Mined References (3)

PMID Year Title