Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.43
PubTator Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00301877501574065
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00706762999886839
oligodendroglioma 2849 0.0197942829590098
acute myeloid leukemia 785 0.0327357706068462

Expression

Synonym

Accession Q6T311
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
18976975 Knockdown of ADP-ribosylation factor-like 9 (ARL9) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MRPTWKALSHPAWPEEKNKQILVLGLDGAGKTSVLHSLASNRVQHSVAPTQGFHAVCINTEDSQMEFLEI      1 - 70
GGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIH     71 - 140
EALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ                           141 - 187
//

Text Mined References (3)

PMID Year Title
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15033445 2004 RASL11A, member of a novel small monomeric GTPase gene family, is down-regulated in prostate tumors.