Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.43
PubTator Score 0.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
18976975 Knockdown of ADP-ribosylation factor-like 9 (ARL9) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MRPTWKALSHPAWPEEKNKQILVLGLDGAGKTSVLHSLASNRVQHSVAPTQGFHAVCINTEDSQMEFLEI      1 - 70
GGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIH     71 - 140
EALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ                           141 - 187
//

Text Mined References (3)

PMID Year Title
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15033445 2004 RASL11A, member of a novel small monomeric GTPase gene family, is down-regulated in prostate tumors.