Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.40
PubTator Score 1.02

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count
Endometriosis 535
Disease Target Count Z-score Confidence
substance-related disorder 105 0.0 2.0



Accession Q6T310 B2RN97


  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish EggNOG Inparanoid

Gene RIF (2)

20168301 In transient transfection experiments, RasL11a enhanced the transcriptional activity of an RNA polymerase I-specific reporter controlled by the rDNA enhancer/promoter region.
15033445 RASL11A is down-regulated in prostate tumors as measured by quantitative real-time PCR. This result suggests that this gene may have a tumor suppressor role in prostate cancer.

AA Sequence

IIPRPRSPNMQDLKRRFKQALSPKVKAPSALG                                          211 - 242

Text Mined References (7)

PMID Year Title
20168301 2010 Chromatin association and regulation of rDNA transcription by the Ras-family protein RasL11a.
17628721 Cloning, genomic organization, and tissue-specific expression of the RASL11B gene.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15033445 2004 RASL11A, member of a novel small monomeric GTPase gene family, is down-regulated in prostate tumors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.