Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.40
PubTator Score 1.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Endometriosis 540 0.0 0.0
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 0.8
substance-related disorder 162 0.0 2.7
Disease Target Count Z-score Confidence
Primary cutaneous amyloidosis 29 3.001 1.5

Expression

Gene RIF (2)

AA Sequence

MRPLSMSGHFLLAPIPESSSDYLLPKDIKLAVLGAGRVGKSAMIVRFLTKRFIGDYEPNTGKLYSRLVYV      1 - 70
EGDQLSLQIQDTPGGVQIQDSLPQVVDSLSKCVQWAEGFLLVYSITDYDSYLSIRPLYQHIRKVHPDSKA     71 - 140
PVIIVGNKGDLLHARQVQTQDGIQLANELGSLFLEISTSENYEDVCDVFQHLCKEVSKMHGLSGERRRAS    141 - 210
IIPRPRSPNMQDLKRRFKQALSPKVKAPSALG                                          211 - 242
//

Text Mined References (7)

PMID Year Title