Property Summary

NCBI Gene PubMed Count 23
PubMed Score 163.88
PubTator Score 66.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.300 7.8e-06
lung carcinoma 1.100 2.1e-28
malignant mesothelioma -2.700 5.5e-08
medulloblastoma, large-cell 1.300 1.6e-05
osteosarcoma -1.773 3.5e-05
psoriasis -1.600 3.6e-04

Gene RIF (16)

AA Sequence

MVLTLLLSAYKLCRFFAMSGPRPGAERLAVPGPDGGGGTGPWWAAGGRGPREVSPGAGTEVQDALERALP      1 - 70
ELQQALSALKQAGGARAVGAGLAEVFQLVEEAWLLPAVGREVAQGLCDAIRLDGGLDLLLRLLQAPELET     71 - 140
RVQAARLLEQILVAENRDRVARIGLGVILNLAKEREPVELARSVAGILEHMFKHSEETCQRLVAAGGLDA    141 - 210
VLYWCRRTDPALLRHCALALGNCALHGGQAVQRRMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATN    211 - 280
KEVEREVERSGTLALVEPLVASLDPGRFARCLVDASDTSQGRGPDDLQRLVPLLDSNRLEAQCIGAFYLC    281 - 350
AEAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTW    351 - 420
LQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADW    421 - 490
LGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGD    491 - 560
TPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCM    561 - 630
QDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQ    631 - 700
GRSSRDSSAGSDTSLEGAAPMGPT                                                  701 - 724
//

Text Mined References (25)

PMID Year Title