Property Summary

NCBI Gene PubMed Count 23
Grant Count 37
R01 Count 24
Funding $4,723,715.04
PubMed Score 143.94
PubTator Score 66.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -2.700 0.000
psoriasis -1.600 0.000
osteosarcoma -1.773 0.000
medulloblastoma, large-cell 1.300 0.000
group 3 medulloblastoma 1.400 0.000
lung carcinoma 1.100 0.000

Gene RIF (16)

PMID Text
26844829 Active nerve degeneration requires SARM1 and MAP kinases, including DLK, while the NAD+ synthetic enzyme NMNAT2 prevents degeneration.
26592460 Data show that sterile alpha- and armadillo-motif-containing protein (SARM) modulates MyD88 protein-mediated Toll-like receptors (TLRs) activation through BB-loop dependent interleukin-1 receptor (TIR) TIR-TIR interactions.
24840802 Rapid Wallerian degeneration requires the pro-degenerative molecules SARM1.
24021647 Data found that the UXT isoforms elicit dual opposing regulatory effects on SARM-induced apoptosis.
23923041 The innate immunity adaptor SARM translocates to the nucleus to stabilize lamins and prevent DNA fragmentation in response to pro-apoptotic signaling.
23885119 These results indicate that association of PINK1 with SARM1 and TRAF6 is an important step for mitophagy.
23175186 SARM overexpression caused mitochondrial clustering which has also been observed in several cell death phenomenon.
22145856 The N-terminal 27 amino acids (S27) of SARM, which is hydrophobic and polybasic, acts as a mitochondria-targeting signal sequence, associating SARM to the mitochondria. The S27 peptide has an inherent ability to bind to lipids and mitochondria.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MVLTLLLSAYKLCRFFAMSGPRPGAERLAVPGPDGGGGTGPWWAAGGRGPREVSPGAGTEVQDALERALP      1 - 70
ELQQALSALKQAGGARAVGAGLAEVFQLVEEAWLLPAVGREVAQGLCDAIRLDGGLDLLLRLLQAPELET     71 - 140
RVQAARLLEQILVAENRDRVARIGLGVILNLAKEREPVELARSVAGILEHMFKHSEETCQRLVAAGGLDA    141 - 210
VLYWCRRTDPALLRHCALALGNCALHGGQAVQRRMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATN    211 - 280
KEVEREVERSGTLALVEPLVASLDPGRFARCLVDASDTSQGRGPDDLQRLVPLLDSNRLEAQCIGAFYLC    281 - 350
AEAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTW    351 - 420
LQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADW    421 - 490
LGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGD    491 - 560
TPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCM    561 - 630
QDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQ    631 - 700
GRSSRDSSAGSDTSLEGAAPMGPT                                                  701 - 724
//

Text Mined References (25)

PMID Year Title
26844829 2016 Axon Self-Destruction: New Links among SARM1, MAPKs, and NAD+ Metabolism.
26592460 2016 SARM modulates MyD88-mediated TLR activation through BB-loop dependent TIR-TIR interactions.
25080503 2014 Meta-analysis of genome-wide association studies identifies two loci associated with circulating osteoprotegerin levels.
24840802 2014 Wallerian degeneration: an emerging axon death pathway linking injury and disease.
24021647 2013 UXT plays dual opposing roles on SARM-induced apoptosis.
23923041 2013 The innate immunity adaptor SARM translocates to the nucleus to stabilize lamins and prevent DNA fragmentation in response to pro-apoptotic signaling.
23885119 2013 SARM1 and TRAF6 bind to and stabilize PINK1 on depolarized mitochondria.
23175186 2013 T-cell death following immune activation is mediated by mitochondria-localized SARM.
22145856 2012 Targeting of pro-apoptotic TLR adaptor SARM to mitochondria: definition of the critical region and residues in the signal sequence.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
More...