Property Summary

NCBI Gene PubMed Count 24
PubMed Score 22.07
PubTator Score 13.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
breast carcinoma -1.100 1.9e-03
cystic fibrosis -1.236 8.8e-06
glioblastoma -1.100 1.6e-02
group 3 medulloblastoma 1.400 1.3e-03
intraductal papillary-mucinous adenoma (... -1.600 8.8e-05
intraductal papillary-mucinous carcinoma... -1.400 1.7e-02
intraductal papillary-mucinous neoplasm ... -1.600 1.1e-03
malignant mesothelioma -2.500 5.9e-08
medulloblastoma, large-cell -2.400 1.3e-04
osteosarcoma -1.168 3.7e-02
ovarian cancer -2.400 9.0e-06
pituitary cancer 1.600 4.5e-07
tuberculosis 1.300 1.5e-05

Gene RIF (10)

AA Sequence

MAADEVAGGARKATKSKLFEFLVHGVRPGMPSGARMPHQGAPMGPPGSPYMGSPAVRPGLAPAGMEPARK      1 - 70
RAAPPPGQSQAQSQGQPVPTAPARSRSAKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKR     71 - 140
VDIQEALKRPMKQKRKLRLYISNTFNPAKPDAEDSDGSIASWELRVEGKLLDDPSKQKRKFSSFFKSLVI    141 - 210
ELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDLSVRCTLLLMLDYQPPQFKLDPRLARLLGLHTQSR    211 - 280
SAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQRLTALLLPPDPIVINHVISVDPS    281 - 350
DQKKTACYDIDVEVEEPLKGQMSSFLLSTANQQEISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYV    351 - 420
QDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT           421 - 483
//

Text Mined References (29)

PMID Year Title