Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.07
PubTator Score 9.86

Knowledge Summary


No data available


  Differential Expression (7)


Accession Q6SJ93 B4E2G2 Q6P661
Symbols CANP


  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

 Compartment GO Term (2)

Gene RIF (1)

24268661 Mutations in FAM111B cause hereditary fibrosing poikiloderma with tendon contracture, myopathy, and pulmonary fibrosis.

AA Sequence

LYKSLNDEKLETYDEEKGKQESSLQDHQIEPMEC                                        701 - 734

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24268661 2013 Mutations in FAM111B cause hereditary fibrosing poikiloderma with tendon contracture, myopathy, and pulmonary fibrosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.