Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.61
PubTator Score 5.21

Knowledge Summary

Patent (1,552)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Oligospermia 36 5.377 2.7
Azoospermia 110 4.212 2.1

Expression

Gene RIF (4)

AA Sequence

MGKGDVLEAAPTTTAYHSLMDEYGYEVGKAIGHGSYGSVYEAFYTKQKVMVAVKIISKKKASDDYLNKFL      1 - 70
PREIQVMKVLRHKYLINFYRAIESTSRVYIILELAQGGDVLEWIQRYGACSEPLAGKWFSQLTLGIAYLH     71 - 140
SKSIVHRDLKLENLLLDKWENVKISDFGFAKMVPSNQPVGCSPSYRQVNCFSHLSQTYCGSFAYACPEIL    141 - 210
RGLPYNPFLSDTWSMGVILYTLVVAHLPFDDTNLKKLLRETQKEVTFPANHTISQECKNLILQMLRQATK    211 - 280
RATILDIIKDSWVLKFQPEQPTHEIRLLEAMCQLHNTTKQHQSLQITT                          281 - 328
//

Text Mined References (10)

PMID Year Title