Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
Funding $38,681
PubMed Score 5.58
PubTator Score 5.21

Knowledge Summary

Patent (1,552)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Oligospermia 30 5.344 2.7
Azoospermia 89 4.206 2.1

Expression

Synonym

Accession Q6SA08 Q2TA60 Q6ZNM2 TSK-4
Symbols TSK4
TSK-4
TSSK5
STK22E
C14orf20

Gene

 Grant Application (2)

 Collection (1)

Gene RIF (4)

PMID Text
25877358 TSSK4 was able to induce cell apoptosis in vitro depending on its kinase activity, which leads to abnormal testes weight and apoptosis, shedding light on its function in the process of spermatogenesis and/or spermiogenesis
20378615 Observational study of gene-disease association. (HuGE Navigator)
18390560 association of some single nucleotide polymorphisms in TSSK4 with male infertility.
18390560 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGKGDVLEAAPTTTAYHSLMDEYGYEVGKAIGHGSYGSVYEAFYTKQKVMVAVKIISKKKASDDYLNKFL      1 - 70
PREIQVMKVLRHKYLINFYRAIESTSRVYIILELAQGGDVLEWIQRYGACSEPLAGKWFSQLTLGIAYLH     71 - 140
SKSIVHRDLKLENLLLDKWENVKISDFGFAKMVPSNQPVGCSPSYRQVNCFSHLSQTYCGSFAYACPEIL    141 - 210
RGLPYNPFLSDTWSMGVILYTLVVAHLPFDDTNLKKLLRETQKEVTFPANHTISQECKNLILQMLRQATK    211 - 280
RATILDIIKDSWVLKFQPEQPTHEIRLLEAMCQLHNTTKQHQSLQITT                          281 - 328
//

Text Mined References (10)

PMID Year Title
25877358 2015 Testis specific serine/threonine protein kinase 4 (TSSK4) leads to cell apoptosis relying on its kinase activity.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
18452650 2008 DAZL binds to the transcripts of several Tssk genes in germ cells.
18390560 Mutation screening and association study of the TSSK4 Gene in Chinese infertile men with impaired spermatogenesis.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15964553 2005 TSSK5, a novel member of the testis-specific serine/threonine kinase family, phosphorylates CREB at Ser-133, and stimulates the CRE/CREB responsive pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.