Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ependymoma 4679 4.1e-02

Expression

  Differential Expression (1)

Disease log2 FC p
ependymoma 2.600 4.1e-02

AA Sequence

MERGKKKRISNKLQQTFHHSKEPTFLINQAGLLSSDSYSSLSPETESVNPGENIKTDTQKKRPGTVILSK      1 - 70
LSSRRIISESQLSPPVIPARRPGFRVCYICGREFGSQSIAIHEPQCLQKWHIENSKLPKHLRRPEPSKPQ     71 - 140
SLSSSGSYSLQATNEAAFQSAQAQLLPCESCGRTFLPDHLLVHHRSCKPKGEGPRAPHSNSSDHLTGLKK    141 - 210
ACSGTPARPRTVICYICGKEFGTLSLPIHEPKCLEKWKMENDRLPVELHQPLPQKPQPLPNAQSSQAGPN    211 - 280
QAQLVFCPHCSRIFTSDRLLVHQRSCKTHPYGPKYQNLNLGSKGGLKEYTNSKQQRNRAAPSVTDKVIHA    281 - 350
TQDALGEPGGALCL                                                            351 - 364
//

Text Mined References (3)

PMID Year Title