Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6S8J7 A6ND17 A6ND71 Q6S8J6
Symbols A26A1
POTE8
POTE-8
CT104.3

Gene

 Compartment GO Term (0)

AA Sequence

MVAEVSPKLAASPMKKPFGFRGKMGKWCCCCFPCCRGSGKNNMGAWRDHDDSAFTEPRYHVRREDLGKLH      1 - 70
RAAWWGEVPRADLIVMLRGPGINKRDKKKRTALHLACANGNSEVVSLLLDRQCQLHVFDSKKRTALIKAV     71 - 140
QCQEDECALMLLQHGTDPNLPDMYGNTALHYAVYNEDKLMAKTLLLYGADIESKNKGGLTPLLLAVHGQK    141 - 210
QRMVKFLIKKKANLNALDRFGRTALILAVRCGSASIVSLLLQQNIDVFSQDVFGQTAEDYAVSSHHSIIC    211 - 280
QLLSDYKENQMPNNSSGNSNPEQDLKLTSEEEPQRLKGSENSQHEKVTQEPDINKDCDREVEEEMQKHGS    281 - 350
NNVGLSENLTDGAAAGNGDGGLVPQRKSRKHENQQFPNTEIEEYHRPEKKSNEKNKVKSQIHSVDNLDDI    351 - 420
TWPSEIASEDYDLLFSNYETFTLLIEQLKMDFNDSASLSKIQDAVISEEHLLELKNSHYEQLTVEVEQME    421 - 490
NMVHVLQK                                                                  491 - 498
//

Text Mined References (4)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
16364570 2006 Duplication and extensive remodeling shaped POTE family genes encoding proteins containing ankyrin repeat and coiled coil domains.
15276201 2004 Five POTE paralogs and their splice variants are expressed in human prostate and encode proteins of different lengths.
12475935 2002 POTE, a highly homologous gene family located on numerous chromosomes and expressed in prostate, ovary, testis, placenta, and prostate cancer.