Property Summary

NCBI Gene PubMed Count 13
Grant Count 4
Funding $501,550
PubMed Score 265.99
PubTator Score 34.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
medulloblastoma, large-cell -1.900 0.001
fibroadenoma 1.100 0.002
interstitial cystitis 1.300 0.001
pediatric high grade glioma 1.200 0.047
pilocytic astrocytoma 2.000 0.000
non-inflammatory breast cancer -1.400 0.013
lung carcinoma 1.900 0.000
Pick disease -1.500 0.000
progressive supranuclear palsy -1.500 0.019
ovarian cancer -1.800 0.000

Synonym

Accession Q6S5L8 Q6UXQ3 Q8IYW3
Symbols RaLP
SHCD

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
24430869 The ShcD signaling adaptor facilitates ligand-independent phosphorylation of the EGF receptor.
24036217 ShcD can exist within the nucleus, and its CH2 domain has a critical role in nuclear export of ShcD.
20663410 ShcD interacts with TrkB in a kinase-activity-dependent manner.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20078941 ShcD binds to TrkC in a kinase-activity-dependent manner through its PTB and SH2 domains.
17452444 A new member of the Shc family of docking proteins is characterised, which may mediate a specific aspect of signaling downstream of the MuSK receptor.

AA Sequence

MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGNKGSPQPPHPALAPHLPTE      1 - 70
DATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRS     71 - 140
GTAPPPQQDLVGHRATALTPDSCPLPGPGEPTLRSRQDRHFLQHLLGMGMNYCVRYMGCVEVLQSMRSLD    141 - 210
FGMRTQVTREAISRLCEAVPGANGAIKKRKPPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQ    211 - 280
IIANHHMQSISFASGGDPDTTDYVAYVAKDPVNQRACHILECHNGMAQDVISTIGQAFELRFKQYLKNPS    281 - 350
LNTSCESEEVHIDSHAEEREDHEYYNEIPGKQPPVGGVSDMRIKVQATEQMAYCPIQCEKLCYLPGNSKC    351 - 420
SSVYENCLEQSRAIGNVHPRGVQSQRDTSLLKHTCRVDLFDDPCYINTQALQSTPGSAGNQRSAQPLGSP    421 - 490
WHCGKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLLVKDGDFLVRESATSPGQYVL    491 - 560
SGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDNSLPIISSGSEVSLKQPVRKDNNPALLHSNK    561 - 630
//

Text Mined References (14)

PMID Year Title
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24430869 2014 The ShcD signaling adaptor facilitates ligand-independent phosphorylation of the EGF receptor.
24036217 2014 A nuclear export signal and oxidative stress regulate ShcD subcellular localisation: a potential role for ShcD in the nucleus.
22911880 2012 Genome-wide association analysis of eating disorder-related symptoms, behaviors, and personality traits.
21621269 2011 Genome-wide association analysis of gender differences in major depressive disorder in the Netherlands NESDA and NTR population-based samples.
20663410 2010 ShcD interacts with TrkB via its PTB and SH2 domains and regulates BDNF-induced MAPK activation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20078941 2009 [ShcD interacts with TrkC through its PTB and SH2 domains].
17452444 2007 Analysis of a Shc family adaptor protein, ShcD/Shc4, that associates with muscle-specific kinase.
More...