Property Summary

NCBI Gene PubMed Count 13
PubMed Score 265.99
PubTator Score 34.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 2.88442022837055E-12
ovarian cancer 8492 4.20257596187401E-9
pilocytic astrocytoma 3086 1.00781072755084E-6
Pick disease 1893 4.95188451139866E-4
interstitial cystitis 2299 9.42253421007504E-4
medulloblastoma, large-cell 6234 0.00130056825947948
fibroadenoma 557 0.00175944816585897
non-inflammatory breast cancer 208 0.0130063151128728
progressive supranuclear palsy 674 0.0193738644329877
pediatric high grade glioma 2712 0.04652175984914
Disease Target Count Z-score Confidence
Mental depression 58 0.0 1.0

Expression

  Differential Expression (10)

Disease log2 FC p
medulloblastoma, large-cell -1.900 0.001
fibroadenoma 1.100 0.002
interstitial cystitis 1.300 0.001
pediatric high grade glioma 1.200 0.047
pilocytic astrocytoma 2.000 0.000
non-inflammatory breast cancer -1.400 0.013
lung carcinoma 1.900 0.000
Pick disease -1.500 0.000
progressive supranuclear palsy -1.500 0.019
ovarian cancer -1.800 0.000

Synonym

Accession Q6S5L8 Q6UXQ3 Q8IYW3
Symbols RaLP
SHCD

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Pig EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (6)

PMID Text
24430869 The ShcD signaling adaptor facilitates ligand-independent phosphorylation of the EGF receptor.
24036217 ShcD can exist within the nucleus, and its CH2 domain has a critical role in nuclear export of ShcD.
20663410 ShcD interacts with TrkB in a kinase-activity-dependent manner.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20078941 ShcD binds to TrkC in a kinase-activity-dependent manner through its PTB and SH2 domains.
17452444 A new member of the Shc family of docking proteins is characterised, which may mediate a specific aspect of signaling downstream of the MuSK receptor.

AA Sequence

MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGNKGSPQPPHPALAPHLPTE      1 - 70
DATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRS     71 - 140
GTAPPPQQDLVGHRATALTPDSCPLPGPGEPTLRSRQDRHFLQHLLGMGMNYCVRYMGCVEVLQSMRSLD    141 - 210
FGMRTQVTREAISRLCEAVPGANGAIKKRKPPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQ    211 - 280
IIANHHMQSISFASGGDPDTTDYVAYVAKDPVNQRACHILECHNGMAQDVISTIGQAFELRFKQYLKNPS    281 - 350
LNTSCESEEVHIDSHAEEREDHEYYNEIPGKQPPVGGVSDMRIKVQATEQMAYCPIQCEKLCYLPGNSKC    351 - 420
SSVYENCLEQSRAIGNVHPRGVQSQRDTSLLKHTCRVDLFDDPCYINTQALQSTPGSAGNQRSAQPLGSP    421 - 490
WHCGKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLLVKDGDFLVRESATSPGQYVL    491 - 560
SGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDNSLPIISSGSEVSLKQPVRKDNNPALLHSNK    561 - 630
//

Text Mined References (14)

PMID Year Title
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24430869 2014 The ShcD signaling adaptor facilitates ligand-independent phosphorylation of the EGF receptor.
24036217 2014 A nuclear export signal and oxidative stress regulate ShcD subcellular localisation: a potential role for ShcD in the nucleus.
22911880 2012 Genome-wide association analysis of eating disorder-related symptoms, behaviors, and personality traits.
21621269 2011 Genome-wide association analysis of gender differences in major depressive disorder in the Netherlands NESDA and NTR population-based samples.
20663410 2010 ShcD interacts with TrkB via its PTB and SH2 domains and regulates BDNF-induced MAPK activation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20078941 2009 [ShcD interacts with TrkC through its PTB and SH2 domains].
17452444 2007 Analysis of a Shc family adaptor protein, ShcD/Shc4, that associates with muscle-specific kinase.
More...