Property Summary

NCBI Gene PubMed Count 14
PubMed Score 295.51
PubTator Score 34.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 2.000 1.2e-06
fibroadenoma 1.100 1.8e-03
interstitial cystitis 1.300 9.4e-04
lung carcinoma 1.900 2.9e-12
medulloblastoma, large-cell -1.900 1.3e-03
non-inflammatory breast cancer -1.400 1.3e-02
ovarian cancer -1.800 4.2e-09
pediatric high grade glioma 1.200 4.7e-02
Pick disease -1.500 5.0e-04
progressive supranuclear palsy -1.500 1.9e-02

Protein-protein Interaction (5)

Gene RIF (7)

AA Sequence

MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGNKGSPQPPHPALAPHLPTE      1 - 70
DATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRS     71 - 140
GTAPPPQQDLVGHRATALTPDSCPLPGPGEPTLRSRQDRHFLQHLLGMGMNYCVRYMGCVEVLQSMRSLD    141 - 210
FGMRTQVTREAISRLCEAVPGANGAIKKRKPPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQ    211 - 280
IIANHHMQSISFASGGDPDTTDYVAYVAKDPVNQRACHILECHNGMAQDVISTIGQAFELRFKQYLKNPS    281 - 350
LNTSCESEEVHIDSHAEEREDHEYYNEIPGKQPPVGGVSDMRIKVQATEQMAYCPIQCEKLCYLPGNSKC    351 - 420
SSVYENCLEQSRAIGNVHPRGVQSQRDTSLLKHTCRVDLFDDPCYINTQALQSTPGSAGNQRSAQPLGSP    421 - 490
WHCGKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLLVKDGDFLVRESATSPGQYVL    491 - 560
SGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDNSLPIISSGSEVSLKQPVRKDNNPALLHSNK    561 - 630
//

Text Mined References (15)

PMID Year Title