Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.39
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q6S5H5 A1L153 A6NMI9 Q6S5H6 Q6S8J2
Symbols A26C2
ACTBL1
POTE14
POTE22
CT104.4
POTE-14
POTE14alpha

Gene

 Compartment GO Term (1)

AA Sequence

MVAEAGSMPAASSVKKPFGLRSKMGKWCRHCFPWCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCRHCFP      1 - 70
WCRGSSKSNVGTSGDHDDSAMKTLRSKMGKWCCHCFPCCRGSGKSKVGPWGDYDDSAFMEPRYHVRREDL     71 - 140
DKLHRAAWWGKVPRKDLIVMLKDTDMNKKDKQKRTALHLASANGNSEVVKLLLDRRCQLNILDNKKRTAL    141 - 210
TKAVQCREDECALMLLEHGTDPNIPDEYGNTALHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGV    211 - 280
HEQKQQVVKFLIKKKANLNALDRYGRTALILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSHH    281 - 350
NVICQLLSDYKEKQMLKVSSENSNPEQDLKLTSEEESQRLKGSENSQPEEMSQEPEINKGGDRKVEEEMK    351 - 420
KHGSTHMGFPENLPNGATADNGDDGLIPPRKSRTPESQQFPDTENEQYHSDEQNDTQKQLSEEQNTGILQ    421 - 490
DEILIHEEKQIEVAENEF                                                        491 - 508
//

Text Mined References (6)

PMID Year Title
16824795 2006 Identification of a novel actin isoform in hepatocellular carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15276201 2004 Five POTE paralogs and their splice variants are expressed in human prostate and encode proteins of different lengths.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.