Property Summary

NCBI Gene PubMed Count 7
Grant Count 10
Funding $1,965,033.09
PubMed Score 26.31

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
18976975 Knockdown of POTE ankyrin domain family, member B (POTEB) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MVAEVCSMPAASAVKKPFDLRSKMGKWCHHRFPCCRGSGKSNMGTSGDHDDSFMKTLRSKMGKCCHHCFP      1 - 70
CCRGSGTSNVGTSGDHDNSFMKTLRSKMGKWCCHCFPCCRGSGKSNVGTWGDYDDSAFMEPRYHVRREDL     71 - 140
DKLHRAAWWGKVPRKDLIVMLRDTDMNKRDKQKRTALHLASANGNSEVVQLLLDRRCQLNVLDNKKRTAL    141 - 210
IKAVQCQEDECVLMLLEHGADGNIQDEYGNTALHYAIYNEDKLMAKALLLYGADIESKNKCGLTPLLLGV    211 - 280
HEQKQQVVKFLIKKKANLNALDRYGRTALILAVCCGSASIVNLLLEQNVDVSSQDLSGQTAREYAVSSHH    281 - 350
HVICELLSDYKEKQMLKISSENSNPEQDLKLTSEEESQRLKVSENSQPEKMSQEPEINKDCDREVEEEIK    351 - 420
KHGSNPVGLPENLTNGASAGNGDDGLIPQRKSRKPENQQFPDTENEEYHSDEQNDTQKQLSEEQNTGISQ    421 - 490
DEILTNKQKQIEVAEKEMNSKLSLSHKKEEDLLRENSMLREEIAMLRLELDETKHQNQLRENKILEEIES    491 - 560
VKEKLLKAIQLNEEALTKTSI                                                     561 - 581
//

Publication (7)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19718026 2009 Personalized copy number and segmental duplication maps using next-generation sequencing.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15276201 2004 Five POTE paralogs and their splice variants are expressed in human prostate and encode proteins of different lengths.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475935 2002 POTE, a highly homologous gene family located on numerous chromosomes and expressed in prostate, ovary, testis, placenta, and prostate cancer.