Property Summary

NCBI Gene PubMed Count 27
Grant Count 7
R01 Count 7
Funding $409,194.65
PubMed Score 35.95
PubTator Score 13.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group A ependymoma 2.500 0.000
glioblastoma 2.000 0.000
osteosarcoma -2.565 0.000
atypical teratoid/rhabdoid tumor 2.000 0.000
juvenile dermatomyositis 1.144 0.000
tuberculosis 2.300 0.000
pediatric high grade glioma 2.000 0.000
pilocytic astrocytoma 1.600 0.000
ulcerative colitis 1.400 0.000

Gene RIF (13)

PMID Text
25562590 A role for AT1 receptor-associated proteins in blood pressure regulation
23902639 ATRAP, a directly interacting and functionally inhibiting molecule of AT1R, plays a protective role against the development of systemic insulin resistance via regulatory effects on adipose tissue function.
21728994 The phosphatidylinositol transfer protein RdgBbeta binds 14-3-3 via its unstructured C-terminus, whereas its lipid-binding domain interacts with the integral membrane protein ATRAP (angiotensin II type I receptor-associated protein).
21423001 the GG genotype of the AGTRAP rs11121816 T/G single nucleotide polymorphism was associated with increased mortality in two cohorts of patients who had septic shock.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20541774 CSF angiotensin II, ACE, and ACE2 levels are decreased in neuromyelitis optica/NMO spectrum disorder patients with anti-AQP4 antibody, reflecting severe destruction of perivascular astrocytes
20018811 Small interfering RNA significantly attenuates angiotensin II type 1 receptor-stimulated inositol phosphate formation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19805740 Endogenous increases in angiotensin II during dehydration contribute to dehydration-associated sympathoexcitation.
15668245 CAML is an important signal transducer for the actions of Ang II in regulating the calcineurin-NFAT pathway and the interaction of CAML with ATRAP may mediate the Ang II actions in vascular physiology
More...

AA Sequence

MELPAVNLKVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGGLLATIFLDIV      1 - 70
HISIFYPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAE     71 - 140
APADPFAVPEGRSQDARGY                                                       141 - 159
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25562590 2015 A role for AT1 receptor-associated proteins in blood pressure regulation.
25416956 2014 A proteome-scale map of the human interactome network.
23902639 2013 Angiotensin receptor-binding protein ATRAP/Agtrap inhibits metabolic dysfunction with visceral obesity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21728994 2011 The phosphatidylinositol transfer protein RdgB? binds 14-3-3 via its unstructured C-terminus, whereas its lipid-binding domain interacts with the integral membrane protein ATRAP (angiotensin II type I receptor-associated protein).
21516116 2011 Next-generation sequencing to generate interactome datasets.
21423001 2011 Association of angiotensin II type 1 receptor-associated protein gene polymorphism with increased mortality in septic shock.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...