1. Home
  2. Targets
  3. Type-1 angiotensin II receptor-associated protein

Tbio Type-1 angiotensin II receptor-associated protein

Appears to be a negative regulator of type-1 angiotensin II receptor-mediated signaling by regulating receptor internalisation as well as mechanism of receptor desensitization such as phosphorylation. Induces also a decrease in cell proliferation and angiotensin II-stimulated transcriptional activity.

This gene encodes a transmembrane protein localized to the plasma membrane and perinuclear vesicular structures. The gene product interacts with the angiotensin II type I receptor and negatively regulates angiotensin II signaling. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 27
Grant Count 7
R01 Count 7
Funding $409,194.65
PubMed Score 35.95
PubTator Score 13.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (10)

Disease Z-score Confidence
Hypertension 287 3.61 1.8
atypical teratoid/rhabdoid tumor 1,095
glioblastoma 5,572
juvenile dermatomyositis 1,189
osteosarcoma 7,933
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
tuberculosis 1,557
ulcerative colitis 2,087

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group A ependymoma 2.500 0.000
glioblastoma 2.000 0.000
osteosarcoma -2.565 0.000
atypical teratoid/rhabdoid tumor 2.000 0.000
juvenile dermatomyositis 1.144 0.000
tuberculosis 2.300 0.000
pediatric high grade glioma 2.000 0.000
pilocytic astrocytoma 1.600 0.000
ulcerative colitis 1.400 0.000

Synonym

Accession Q6RW13 A8MVQ5 Q5SNV4 Q5SNV5 Q96AC0 Q96PL4 Q9NRW9
Symbols ATRAP

Gene

AGTRAP

 Grant Application (7)

 GO Function (1)

 GO Component (9)

 GO Process (2)

 Compartment GO Term (42)

See all...

 MGI Term (3)

Pathway (6)

 UniProt Keyword (11)

See all...

Gene RIF (13)

PMID Text
25562590 A role for AT1 receptor-associated proteins in blood pressure regulation
23902639 ATRAP, a directly interacting and functionally inhibiting molecule of AT1R, plays a protective role against the development of systemic insulin resistance via regulatory effects on adipose tissue function.
21728994 The phosphatidylinositol transfer protein RdgBbeta binds 14-3-3 via its unstructured C-terminus, whereas its lipid-binding domain interacts with the integral membrane protein ATRAP (angiotensin II type I receptor-associated protein).
21423001 the GG genotype of the AGTRAP rs11121816 T/G single nucleotide polymorphism was associated with increased mortality in two cohorts of patients who had septic shock.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20541774 CSF angiotensin II, ACE, and ACE2 levels are decreased in neuromyelitis optica/NMO spectrum disorder patients with anti-AQP4 antibody, reflecting severe destruction of perivascular astrocytes
20018811 Small interfering RNA significantly attenuates angiotensin II type 1 receptor-stimulated inositol phosphate formation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19805740 Endogenous increases in angiotensin II during dehydration contribute to dehydration-associated sympathoexcitation.
15668245 CAML is an important signal transducer for the actions of Ang II in regulating the calcineurin-NFAT pathway and the interaction of CAML with ATRAP may mediate the Ang II actions in vascular physiology
More...

AA Sequence 

MELPAVNLKVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGGLLATIFLDIV      1 - 70
HISIFYPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAE     71 - 140
APADPFAVPEGRSQDARGY                                                       141 - 159
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25562590 2015 A role for AT1 receptor-associated proteins in blood pressure regulation.
25416956 2014 A proteome-scale map of the human interactome network.
23902639 2013 Angiotensin receptor-binding protein ATRAP/Agtrap inhibits metabolic dysfunction with visceral obesity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21728994 2011 The phosphatidylinositol transfer protein RdgB? binds 14-3-3 via its unstructured C-terminus, whereas its lipid-binding domain interacts with the integral membrane protein ATRAP (angiotensin II type I receptor-associated protein).
21516116 2011 Next-generation sequencing to generate interactome datasets.
21423001 2011 Association of angiotensin II type 1 receptor-associated protein gene polymorphism with increased mortality in septic shock.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...