Property Summary

NCBI Gene PubMed Count 27
PubMed Score 40.39
PubTator Score 13.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.400 1.1e-04
Astrocytoma, Pilocytic 1.500 3.5e-08
atypical teratoid / rhabdoid tumor 1.900 7.2e-07
ependymoma 1.400 3.8e-02
glioblastoma 1.500 6.4e-09
juvenile dermatomyositis 1.144 4.9e-08
osteosarcoma -2.565 4.9e-08
tuberculosis 2.300 9.3e-10
ulcerative colitis 1.400 1.3e-06

Gene RIF (13)

AA Sequence

MELPAVNLKVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGGLLATIFLDIV      1 - 70
HISIFYPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAE     71 - 140
APADPFAVPEGRSQDARGY                                                       141 - 159
//

Text Mined References (30)

PMID Year Title