Property Summary

NCBI Gene PubMed Count 8
PubMed Score 113.70
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.818 1.9

Expression

Gene RIF (2)

AA Sequence

MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPRASCRLGEEPPPL      1 - 70
PYCDQAYGEELSIRHRETWAWLSRTDTAWPGAPGVKQARILGELLLV                            71 - 117
//

Text Mined References (8)

PMID Year Title