Property Summary

NCBI Gene PubMed Count 8
Grant Count 13
R01 Count 10
Funding $840,199.26
PubMed Score 110.95
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 3.798 1.9

Expression

Gene RIF (2)

PMID Text
18698046 Donor T-cell responses against the HLA-A*0201-restricted minor H antigen encoded by C19orf48 may contribute to renal cell carcinoma regression after MHC-matched allogeneic hematopoietic cell transplantation
12452007 a new drug resistance-related gene closely related to MDR of lung adenocarcinama induced by CDDP.

AA Sequence

MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPRASCRLGEEPPPL      1 - 70
PYCDQAYGEELSIRHRETWAWLSRTDTAWPGAPGVKQARILGELLLV                            71 - 117
//

Text Mined References (8)

PMID Year Title
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
20686220 2010 The human lung cancer drug resistance-related gene BC006151 regulates chemosensitivity in H446/CDDP cells.
18698046 2008 C19orf48 encodes a minor histocompatibility antigen recognized by CD8+ cytotoxic T cells from renal cell carcinoma patients.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12452007 2002 [Cloning and sequence analysis of a new, full-length cDNA fragment of drug resistance-related gene in human lung adenocarcinoma].
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.