Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 4.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 0.006

Gene RIF (1)

PMID Text
26816005 Interactions between DUX4 and DUX4c with cytoplasmic proteins play a major role during muscle differentiation.

AA Sequence

MALPTPSDSTLPAEARGRGRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNE      1 - 70
RSRQLRQHRRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQI     71 - 140
WFQNRRARHPGQGGRAPAQAGGLCSAAPGGGHPAPSWVAFAHTGAWGTGLPAPHVPCAPGALPQGAFVSQ    141 - 210
AARAAPALQPSQAAPAEGISQPAPARGDFAYAAPAPPDGALSHPQAPRWPPHPGKSREDRDPQRDGLPGP    211 - 280
CAVAQPGPAQAGPQGQGVLAPPTSQGSPWWGWGRGPQVAGAAWEPQAGAAPPPQPAPPDASAASTDASHP    281 - 350
GASQPLQEPGRSSTVTSSLLYELL                                                  351 - 374
//

Text Mined References (13)

PMID Year Title
26816005 2016 Homologous Transcription Factors DUX4 and DUX4c Associate with Cytoplasmic Proteins during Muscle Differentiation.
24145033 2013 Defective regulation of microRNA target genes in myoblasts from facioscapulohumeral dystrophy patients.
21937448 2011 The Krüppel-like factor 15 as a molecular link between myogenic factors and a chromosome 4q transcriptional enhancer implicated in facioscapulohumeral dystrophy.
20490329 2010 Testing the effects of FSHD candidate gene expression in vertebrate muscle development.
19829708 2009 DUX4c is up-regulated in FSHD. It induces the MYF5 protein and human myoblast proliferation.
19607661 2009 Remodeling of the chromatin structure of the facioscapulohumeral muscular dystrophy (FSHD) locus and upregulation of FSHD-related gene 1 (FRG1) expression during human myogenic differentiation.
18723017 2008 DUX4c, an FSHD candidate gene, interferes with myogenic regulators and abolishes myoblast differentiation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
10512680 1999 The FSHD region on human chromosome 4q35 contains potential coding regions among pseudogenes and a high density of repeat elements.
10433963 1999 Nucleotide sequence of the partially deleted D4Z4 locus in a patient with FSHD identifies a putative gene within each 3.3 kb element.
More...