Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 4.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.9e-03

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 5.9e-03

Gene RIF (1)

AA Sequence

MALPTPSDSTLPAEARGRGRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNE      1 - 70
RSRQLRQHRRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQI     71 - 140
WFQNRRARHPGQGGRAPAQAGGLCSAAPGGGHPAPSWVAFAHTGAWGTGLPAPHVPCAPGALPQGAFVSQ    141 - 210
AARAAPALQPSQAAPAEGISQPAPARGDFAYAAPAPPDGALSHPQAPRWPPHPGKSREDRDPQRDGLPGP    211 - 280
CAVAQPGPAQAGPQGQGVLAPPTSQGSPWWGWGRGPQVAGAAWEPQAGAAPPPQPAPPDASAASTDASHP    281 - 350
GASQPLQEPGRSSTVTSSLLYELL                                                  351 - 374
//

Text Mined References (13)

PMID Year Title