Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.30
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Neoplasms 63 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 7.0e-06

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.300 7.0e-06

Gene RIF (2)

AA Sequence

MAAAAARWNHVWVGTETGILKGVNLQRKQAANFTAGGQPRREEAVSALCWGTGGETQMLVGCADRTVKHF      1 - 70
STEDGIFQGQRHCPGGEGMFRGLAQADGTLITCVDSGILRVWHDKDKDTSSDPLLELRVGPGVCRMRQDP     71 - 140
AHPHVVATGGKENALKIWDLQGSEEPVFRAKNVRNDWLDLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVY    141 - 210
DPASPQRRPVLETTYGEYPLTAMTLTPGGNSVIVGNTHGQLAEIDLRQGRLLGCLKGLAGSVRGLQCHPS    211 - 280
KPLLASCGLDRVLRIHRIQNPRGLEHKVYLKSQLNCLLLSGRDNWEDEPQEPQEPNKVPLEDTETDELWA    281 - 350
SLEAAAKRKLSGLEQPQGALQTRRRKKKRPGSTSP                                       351 - 385
//

Text Mined References (16)

PMID Year Title