Property Summary

NCBI Gene PubMed Count 22
Grant Count 1
R01 Count 1
Funding $119,021.33
PubMed Score 10.89
PubTator Score 4.49

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6R6M4 USP17
Symbols DUB3
DUB-3
USP17

Gene

 Grant Application (1)

Gene RIF (7)

PMID Text
26617781 In cigarette smoke extract-exposed airway epithelial cells and macrophages, HDAC2 is excessively ubiquitinated and degraded in the proteasome attributed to low expression of USP17.
25776484 These data indicate that the Dub3 might be a valuable biomarker for the prediction of ovarian cancer prognosis and Dub3 inhibition might be a potential strategy for ovarian cancer treatment.
24704006 Dub3 counteracts H2AX E3 ligases RNF8 and RNF168. Moreover, Dub3 and H2AX interact and Dub3 deubiquitinates H2AX in vitro.
23773437 Recently, much progress has been made in understanding the physiological functions of cytokine-inducible DUBs such as DUB-1, DUB-2, and DUB-3/USP17, in regulation of cell proliferation and apoptosis in lymphocytes. [review]
20228808 As a major regulator of Cdc25A, Dub3 is an example of a transforming ubiquitin hydrolase that subverts a key component of the cell cycle machinery, promoting oncogenic transformation.
19718026 Identifies DUB3 as being one of 30 genes with the most variable copy numbers in three human genomes.
14699124 human DUB-3, like the murine DUB family members, is transiently induced in response to cytokines and can, when constitutively expressed, block growth factor-dependent proliferation.

AA Sequence

MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSSEARVDLCDDLAPVARQLAPRKKLPL      1 - 70
SSRRPAAVGAGLQNMGNTCYENASLQCLTYTPPLANYMLSREHSQTCQRPKCCMLCTMQAHITWALHSPG     71 - 140
HVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMKKACLPGHKQVDHHSKDTTLIHQIFGGCWRSQIKCLHC    141 - 210
HGISDTFDPYLDIALDIQAAQSVKQALEQLVKPEELNGENAYHCGLCLQRAPASKTLTLHTSAKVLILVL    211 - 280
KRFSDVTGNKLAKNVQYPECLDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHDGHYFSYVKAQEGQWYKMD    281 - 350
DAKVTACSITSVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL    351 - 420
DERLVERATQESTLDHWKFPQEQNKTKPEFNVRKVEGTLPPNVLVIHQSKYKCGMKNHHPEQQSSLLNLS    421 - 490
STTRTDQESVNTGTLASLQGRTRRSKGKNKHSKRALLVCQ                                  491 - 530
//

Text Mined References (23)

PMID Year Title
26617781 2015 USP17-mediated deubiquitination and stabilization of HDAC2 in cigarette smoke extract-induced inflammation.
25776484 2015 Dub3 expression correlates with tumor progression and poor prognosis in human epithelial ovarian cancer.
24704006 2014 Dub3 controls DNA damage signalling by direct deubiquitination of H2AX.
23773437 2013 Molecular mechanisms and functions of cytokine-inducible deubiquitinating enzymes.
21448158 2011 The deubiquitinating enzyme USP17 is essential for GTPase subcellular localization and cell motility.
21239494 2011 Lys-63-specific deubiquitination of SDS3 by USP17 regulates HDAC activity.
20715989 2010 Polyclonal and monoclonal antibodies specific for USP17, a proapoptotic deubiquitinating enzyme.
20403174 2010 The DUB/USP17 deubiquitinating enzymes: a gene family within a tandemly repeated sequence, is also embedded within the copy number variable beta-defensin cluster.
20388806 2010 The deubiquitinating enzyme USP17 is highly expressed in tumor biopsies, is cell cycle regulated, and is required for G1-S progression.
20368735 2010 The ubiquitin-specific protease 17 is involved in virus-triggered type I IFN signaling.
More...