Property Summary

NCBI Gene PubMed Count 77
Grant Count 172
R01 Count 94
Funding $12,449,105.08
PubMed Score 560.31
PubTator Score 390.61

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6R327 B2RNX0 B7ZMF7 Q68DT5 Q86UB7 Q8N3A0 Q8NCM6
Symbols PIA
AVO3
hAVO3

Gene

 GO Component (2)

Protein-protein Interaction (4)

Gene RIF (56)

PMID Text
26600389 Mdm20 acts as a novel regulator of Rictor, thereby controlling mTORC2 activity, and leading to the activation of PKCalphaS657 and FoxO1.
26453307 RICTOR/MTORC2-AKT can integrate convergent hormonal and metabolic signals to provide coordinated and sensitive regulation of hepatic FOXO1-target gene expression.
26370156 RICTOR amplification may define a novel and unique molecular subset of patients with lung cancer who may benefit from treatment with mTORC1/2 inhibitors.
26363527 the expressions of Beclin1, Raptor, and Rictor are related to the development and progression of colorectal carcinoma and multidrug resistance.
26356562 Data show that rapamycin-insensitive companion of mTOR protein (RICTOR) plays a central role in phosphatidylinositol 3-kinase (PI3K)/proto-oncogene protein c-akt (AKT) pathway in melanocytes and its deregulation could be involved in melanoma development.
26170313 glucose-dependent acetylation of Rictor, a central component of mechanistic target of rapamycin complex 2 (mTORC2), promotes tumor growth and resistance to epidermal growth factor receptor (EGFR)-, PI3K-, and AKT-targeted therapies
26159923 results suggest that mTORC2/Rictor/pAkt may play a more important role than mTORC1/pS6 in tumor progression, which could act as a prognostic biomarker or potential therapeutic target in gastric cancer
25897075 analysis of how Rictor undergoes GSK3-dependent, FBXW7-mediated ubiquitination and proteasomal degradation
25893736 A new dimension in mTOR-rictor relationship.
25714006 phosphorylation of Rictor at Ser1162 by Plk1 might be involved in a novel signaling pathway.
More...

AA Sequence

MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDI      1 - 70
GHSEEKLGFHYEDIIICLRLALLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDIQQSNE     71 - 140
VERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQERDRMVRACIAIICELALQNPEVVALRGGLNT    141 - 210
ILKNVIDCQLSRINEALITTILHLLNHPKTRQYVRADVELERILAPYTDFHYRHSPDTAEGQLKEDREAR    211 - 280
FLASKMGIIATFRSWAGIINLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVTEEFIEAL    281 - 350
LSVDPGRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHIS    351 - 420
VRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASFDIPKEKRLRASAALNCLKRFHEMKKRGPKPY    421 - 490
SLHLDHIIQKAIATHQKRDQYLRVQKDIFILKDTEEALLINLRDSQVLQHKENLEWNWNLIGTILKWPNV    491 - 560
NLRNYKDEQLHRFVRRLLYFYKPSSKLYANLDLDFAKAKQLTVVGCQFTEFLLESEEDGQGYLEDLVKDI    561 - 630
VQWLNASSGMKPERSLQNNGLLTTLSQHYFLFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLLKL    631 - 700
TVSSLDYSRDGLARVILSKILTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEA    701 - 770
LDILDEACEDKANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHREYNSKYV    771 - 840
DLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVR    841 - 910
TPDLDKWEEIKKLKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCEVLSIRGTCVYVLGLIAKTKQ    911 - 980
GCDILKCHNWDAVRHSRKHLWPVVPDDVEQLCNELSSIPSTLSLNSESTSSRHNSESESVPSSMFILEDD    981 - 1050
RFGSSSTSTFFLDINEDTEPTFYDRSGPIKDKNSFPFFASSKLVKNRILNSLTLPNKKHRSSSDPKGGKL   1051 - 1120
SSESKTSNRRIRTLTEPSVDFNHSDDFTPISTVQKTLQLETSFMGNKHIEDTGSTPSIGENDLKFTKNFG   1121 - 1190
TENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSGISSMSSSPSRETVGVDATTMDTDCGSMSTVVS   1191 - 1260
TKTIKTSHYLTPQSNHLSLSKSNSVSLVPPGSSHTLPRRAQSLKAPSIATIKSLADCNFSYTSSRDAFGY   1261 - 1330
ATLKRLQQQRMHPSLSHSEALASPAKDVLFTDTITMKANSFESRLTPSRFMKALSYASLDKEDLLSPINQ   1331 - 1400
NTLQRSSSVRSMVSSATYGGSDDYIGLALPVDINDIFQVKDIPYFQTKNIPPHDDRGARAFAHDAGGLPS   1401 - 1470
GTGGLVKNSFHLLRQQMSLTEIMNSIHSDASLFLESTEDTGLQEHTDDNCLYCVCIEILGFQPSNQLSAI   1471 - 1540
CSHSDFQDIPYSDWCEQTIHNPLEVVPSKFSGISGCSDGVSQEGSASSTKSTELLLGVKTIPDDTPMCRI   1541 - 1610
LLRKEVLRLVINLSSSVSTKCHETGLLTIKEKYPQTFDDICLYSEVSHLLSHCTFRLPCRRFIQELFQDV   1611 - 1680
QFLQMHEEAEAVLATPPKQPIVDTSAES                                             1681 - 1708
//

Publication (93)

PMID Year Title
26600389 2015 Mdm20 Modulates Actin Remodeling through the mTORC2 Pathway via Its Effect on Rictor Expression.
26453307 2016 Hepatic FOXO1 Target Genes Are Co-regulated by Thyroid Hormone via RICTOR Protein Deacetylation and MTORC2-AKT Protein Inhibition.
26370156 2015 RICTOR Amplification Defines a Novel Subset of Patients with Lung Cancer Who May Benefit from Treatment with mTORC1/2 Inhibitors.
26363527 2015 Autophagy-related genes Raptor, Rictor, and Beclin1 expression and relationship with multidrug resistance in colorectal carcinoma.
26356562 2015 RICTOR involvement in the PI3K/AKT pathway regulation in melanocytes and melanoma.
26170313 2015 Glucose-dependent acetylation of Rictor promotes targeted cancer therapy resistance.
26159923 2015 Elevated Rictor expression is associated with tumor progression and poor prognosis in patients with gastric cancer.
25897075 2015 Rictor Undergoes Glycogen Synthase Kinase 3 (GSK3)-dependent, FBXW7-mediated Ubiquitination and Proteasomal Degradation.
25893736 2015 A carbazole alkaloid deactivates mTOR through the suppression of rictor and that induces apoptosis in lung cancer cells.
25714006 2015 Identification of rictor as a novel substrate of Polo-like kinase 1.
More...