Property Summary

NCBI Gene PubMed Count 23
PubMed Score 759.59
PubTator Score 457.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia 1.900 4.8e-02
juvenile dermatomyositis 1.063 2.8e-07
medulloblastoma -1.100 3.1e-04
medulloblastoma, large-cell -1.500 4.2e-05
ovarian cancer -1.300 2.3e-05
pancreatic cancer 1.200 5.7e-03
primary pancreatic ductal adenocarcinoma 1.172 4.4e-03
primary Sjogren syndrome 1.100 5.6e-03

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMN      1 - 70
KLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLE     71 - 140
KR                                                                        141 - 142
//

Text Mined References (27)

PMID Year Title