Property Summary

NCBI Gene PubMed Count 23
Grant Count 13
R01 Count 11
Funding $857,231.91
PubMed Score 714.27
PubTator Score 457.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.500 0.000
juvenile dermatomyositis 1.063 0.000
primary pancreatic ductal adenocarcinoma 1.172 0.004
primary Sjogren syndrome 1.100 0.006
acute myeloid leukemia 1.900 0.048
ovarian cancer 2.200 0.000
pancreatic cancer 1.200 0.006

Gene RIF (4)

PMID Text
20308062 WASH is a bimodular protein and a component of the BLOC-1 complex in which the C terminus is involved in Arp2/3-mediated actin nucleation, whereas the N-terminal portion is required for its regulation and localization in the cells
19083121 we have explored ways of efficiently gathering high-quality information about candidate binding partners fob bloc1s2
18188704 BLOC1S2 protein is widely expressed in normal tissue as well as in malignant tumors with a tendency towards lower expression levels in certain subtypes of tumors. Over-expression of BLOC1S2 in the presence or absence of HIPPI does not induce apoptosis.
15102850 Biogenesis of lysosome-related organelles complex-1 (BLOC-1) subunit 2 (BLOS2).BLOC-1 is required for the biogenesis of melanosomes and platelet dense granules.

AA Sequence

MAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMN      1 - 70
KLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLE     71 - 140
KR                                                                        141 - 142
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25898167 2015 BORC, a multisubunit complex that regulates lysosome positioning.
25416956 2014 A proteome-scale map of the human interactome network.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22203680 2012 Assembly and architecture of biogenesis of lysosome-related organelles complex-1 (BLOC-1).
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21269460 2011 Initial characterization of the human central proteome.
20308062 2010 Functional characterization of Wiskott-Aldrich syndrome protein and scar homolog (WASH), a bi-modular nucleation-promoting factor able to interact with biogenesis of lysosome-related organelle subunit 2 (BLOS2) and gamma-tubulin.
19083121 2009 A data-mining approach to rank candidate protein-binding partners-The case of biogenesis of lysosome-related organelles complex-1 (BLOC-1).
More...