Property Summary

NCBI Gene PubMed Count 13
Grant Count 14
R01 Count 7
Funding $5,601,037.93
PubMed Score 34.25
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.021

Gene RIF (5)

PMID Text
25314148 study identified an association between FIGLA gene variants and the occurrence of premature ovarian failure(POF) in the Indian population; findings suggest that the c.427G->C and c.557C->T alleles lead to an increased risk of POF in Indian women
18502569 may have a role in the development of primordial follicle before zona pellucida formation
18499083 the p.140 delN mutation disrupted FIGLA binding to the TCF3 helix-loop-helix (HLH) domain. Our findings show that a subset of Chinese women with sporadic, premature ovarian failure harbor mutations in FIGLA.
15044608 These results suggest that FIGLA is involved in continued oocyte survival as primordial follicles form in the human as in the rodent ovary.
12468641 Expression of mRNA observed in ovarian follicles, mature oocytes, and less frequently in preimplantation embryos.

AA Sequence

MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENLQLVLERRRVA      1 - 70
NAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDLLEGAKDSKKQDPDEQSYSNN     71 - 140
SSESHTSSARQLSRNITQHISCAFGLKNEEEGPWADGGSGEPAHACRHSVMSTTEIISPTRSLDRFPEVE    141 - 210
LLSHRLPQV                                                                 211 - 219
//

Text Mined References (14)

PMID Year Title
25314148 2015 Mutational analysis of the FIGLA gene in women with idiopathic premature ovarian failure.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
19610175 2009 Premature ovarian failure and gene polymorphisms.
19258411 2009 Gene expression analysis of human fetal ovarian primordial follicle formation.
18502569 2008 Zona pellucida components are present in human fetal ovary before follicle formation.
18499083 2008 Transcription factor FIGLA is mutated in patients with premature ovarian failure.
17305537 2007 Candidate genes for premature ovarian failure.
16143663 Transcriptional regulation of early oogenesis: in search of masters.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...