Property Summary

NCBI Gene PubMed Count 13
PubMed Score 36.37
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Premature Ovarian Failure 6 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.1e-02
Disease Target Count Z-score Confidence
Premature ovarian failure 65 5.578 2.8
Disease Target Count Z-score Confidence
Hermaphroditism 9 4.851 2.4
Infertility 188 3.907 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 2.1e-02

Gene RIF (5)

AA Sequence

MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENLQLVLERRRVA      1 - 70
NAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDLLEGAKDSKKQDPDEQSYSNN     71 - 140
SSESHTSSARQLSRNITQHISCAFGLKNEEEGPWADGGSGEPAHACRHSVMSTTEIISPTRSLDRFPEVE    141 - 210
LLSHRLPQV                                                                 211 - 219
//

Text Mined References (14)

PMID Year Title