Property Summary

Ligand Count 8
NCBI Gene PubMed Count 12
PubMed Score 114.25
PubTator Score 26.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Stroke 33 0.0 0.0
Disease Target Count
Cerebrovascular accident 63
Disease Target Count P-value
osteosarcoma 7950 8.8e-08
medulloblastoma, large-cell 6241 2.5e-05
psoriasis 6694 3.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.300 2.5e-05
osteosarcoma -2.088 8.8e-08
psoriasis 1.200 3.1e-03

 GO Component (1)

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MESTGSVGEAPGGPRVLVVGGGIAGLGAAQRLCGHSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHW      1 - 70
IHGPSRGNPVFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGTSVSLQLVAEMATLFYGLIDQ     71 - 140
TREFLHAAETPVPSVGEYLKKEIGQHVARLCGHSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIH    141 - 210
GPSRGNPVFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGASVSLQLVAEMATLFYGLIDQTR    211 - 280
EFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLKLAVLNSFFNLECCVSGTHSMDLVALAPFGEYT    281 - 350
VLPGLDCTFSKGYQGLTNCMMAALPEDTVVFEKPVKTIHWNGSFQEAAFPGETFPVSVECEDGDRFPAHH    351 - 420
VIVTVPLGFLREHLDTFFDPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQLVWEDTSPLEDA    421 - 490
APELQDAWFRKLIGFVVLPAFASVHVLCGFIAGLESEFMETLSDEEVLLCLTQVLRRVTGNPRLPAPKSV    491 - 560
LRSRWHSAPYTRGSYSYVAVGSTGGDLDLLAQPLPADGAGAQLQILFAGEATHRTFYSTTHGALLSGWRE    561 - 630
ADRLLSLWAPQVQQPRPRL                                                       631 - 649
//

Text Mined References (15)

PMID Year Title