Property Summary

NCBI Gene PubMed Count 12
Grant Count 67
R01 Count 50
Funding $6,963,694.22
PubMed Score 112.95
PubTator Score 26.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.200 0.003
osteosarcoma -2.088 0.000
medulloblastoma, large-cell -1.500 0.000

Gene

 GO Component (1)

Gene RIF (4)

PMID Text
26547506 copy number gain in the polyamine oxidase (PAOX) gene locus was accompanied by a coordinated transcriptional up-regulation in Primary myelofibrosis patients
20405312 PAO activity in children with type 1 diabetes mellitus was very high; higher blood HbA(1C) and MDA levels confirm the presence of oxidant stress demonstrate that PAO activity may participate in these circumstances
16354669 polyamine oxidase degrades alpha-methylpolyamines in a stereospecific manner
16207710 SSAT and SMO(PAOh1) activities are the major mediators of the cellular response of breast tumor cells to polyamines while PAO plays little or no role in this response

AA Sequence

MESTGSVGEAPGGPRVLVVGGGIAGLGAAQRLCGHSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHW      1 - 70
IHGPSRGNPVFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGTSVSLQLVAEMATLFYGLIDQ     71 - 140
TREFLHAAETPVPSVGEYLKKEIGQHVARLCGHSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIH    141 - 210
GPSRGNPVFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGASVSLQLVAEMATLFYGLIDQTR    211 - 280
EFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLKLAVLNSFFNLECCVSGTHSMDLVALAPFGEYT    281 - 350
VLPGLDCTFSKGYQGLTNCMMAALPEDTVVFEKPVKTIHWNGSFQEAAFPGETFPVSVECEDGDRFPAHH    351 - 420
VIVTVPLGFLREHLDTFFDPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQLVWEDTSPLEDA    421 - 490
APELQDAWFRKLIGFVVLPAFASVHVLCGFIAGLESEFMETLSDEEVLLCLTQVLRRVTGNPRLPAPKSV    491 - 560
LRSRWHSAPYTRGSYSYVAVGSTGGDLDLLAQPLPADGAGAQLQILFAGEATHRTFYSTTHGALLSGWRE    561 - 630
ADRLLSLWAPQVQQPRPRL                                                       631 - 649
//

Text Mined References (15)

PMID Year Title
26547506 2016 Integrative analysis of copy number and gene expression data suggests novel pathogenetic mechanisms in primary myelofibrosis.
24816252 2014 An atlas of genetic influences on human blood metabolites.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20405312 2010 Does polyamine oxidase activity influence the oxidative metabolism of children who suffer of diabetes mellitus?
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16354669 2006 Guide molecule-driven stereospecific degradation of alpha-methylpolyamines by polyamine oxidase.
16207710 2005 Spermine oxidase SMO(PAOh1), Not N1-acetylpolyamine oxidase PAO, is the primary source of cytotoxic H2O2 in polyamine analogue-treated human breast cancer cell lines.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...