Property Summary

NCBI Gene PubMed Count 7
PubMed Score 37.81
PubTator Score 20.36

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6QHC5 Q6P492
Symbols DES2
FADS8
C14orf66

Gene

Gene RIF (4)

PMID Text
25871975 Findings demonstrate that a SNP showing genome-wide association study significant association with cognition in schizophrenia is also associated with regulation of DEGS2 expression, implicating a molecular mechanism for the clinical association.
21914808 overexpression of DEGS1 or DEGS2 attenuates the DHC accumulation and increased cell proliferation during hypoxia
20677014 Observational study of gene-disease association. (HuGE Navigator)
15063729 DES2 was identified and its up-regulation followed during keratinocyte differentiation.

AA Sequence

MGNSASRSDFEWVYTDQPHTQRRKEILAKYPAIKALMRPDPRLKWAVLVLVLVQMLACWLVRGLAWRWLL      1 - 70
FWAYAFGGCVNHSLTLAIHDISHNAAFGTGRAARNRWLAVFANLPVGVPYAASFKKYHVDHHRYLGGDGL     71 - 140
DVDVPTRLEGWFFCTPARKLLWLVLQPFFYSLRPLCVHPKAVTRMEVLNTLVQLAADLAIFALWGLKPVV    141 - 210
YLLASSFLGLGLHPISGHFVAEHYMFLKGHETYSYYGPLNWITFNVGYHVEHHDFPSIPGYNLPLVRKIA    211 - 280
PEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLAKDGL                               281 - 323
//

Text Mined References (9)

PMID Year Title
25871975 2015 DEGS2 polymorphism associated with cognition in schizophrenia is associated with gene expression in brain.
21914808 2011 Dihydroceramide-based response to hypoxia.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15063729 2004 Identification of the human sphingolipid C4-hydroxylase, hDES2, and its up-regulation during keratinocyte differentiation.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.