Property Summary

NCBI Gene PubMed Count 7
PubMed Score 46.14
PubTator Score 20.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (4)

AA Sequence

MGNSASRSDFEWVYTDQPHTQRRKEILAKYPAIKALMRPDPRLKWAVLVLVLVQMLACWLVRGLAWRWLL      1 - 70
FWAYAFGGCVNHSLTLAIHDISHNAAFGTGRAARNRWLAVFANLPVGVPYAASFKKYHVDHHRYLGGDGL     71 - 140
DVDVPTRLEGWFFCTPARKLLWLVLQPFFYSLRPLCVHPKAVTRMEVLNTLVQLAADLAIFALWGLKPVV    141 - 210
YLLASSFLGLGLHPISGHFVAEHYMFLKGHETYSYYGPLNWITFNVGYHVEHHDFPSIPGYNLPLVRKIA    211 - 280
PEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLAKDGL                               281 - 323
//

Text Mined References (9)

PMID Year Title