Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.58

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAPALWRACNGLMAAFFALAALVQVNDPDAEVWVVVYTIPAVLTLLVGLNPEVTGNVIWKSISAIHILFC      1 - 70
TVWAVGLASYLLHRTQQNILHEEEGRELSGLVIITAWIILCHSSSKNPVGGRIQLAIAIVITLFPFISWV     71 - 140
YIYINKEMRSSWPTHCKTVI                                                      141 - 160
//

Text Mined References (4)

PMID Year Title
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.