Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -1.265 4.0e-05
atypical teratoid / rhabdoid tumor 1.100 1.1e-02
Breast cancer -1.900 1.2e-22
ductal carcinoma in situ -1.800 4.2e-05
ependymoma 1.100 1.6e-07
intraductal papillary-mucinous neoplasm ... -1.400 1.3e-02
invasive ductal carcinoma -2.000 3.3e-04
ovarian cancer -2.000 2.7e-12
pancreatic ductal adenocarcinoma liver m... -1.569 2.1e-03
subependymal giant cell astrocytoma 1.181 2.3e-02
ulcerative colitis -1.400 5.1e-04
urothelial carcinoma -1.900 4.3e-07

Gene RIF (1)

AA Sequence

MAPALWRACNGLMAAFFALAALVQVNDPDAEVWVVVYTIPAVLTLLVGLNPEVTGNVIWKSISAIHILFC      1 - 70
TVWAVGLASYLLHRTQQNILHEEEGRELSGLVIITAWIILCHSSSKNPVGGRIQLAIAIVITLFPFISWV     71 - 140
YIYINKEMRSSWPTHCKTVI                                                      141 - 160
//

Text Mined References (5)

PMID Year Title