Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 1.15215821168591E-22
ovarian cancer 8492 2.65704672908291E-12
posterior fossa group B ependymoma 1530 2.18649329134945E-11
urothelial carcinoma 318 4.31468750553142E-7
adrenocortical carcinoma 1427 3.95959457409803E-5
ductal carcinoma in situ 1745 4.20838614936217E-5
invasive ductal carcinoma 2950 3.29296481021975E-4
ulcerative colitis 2087 5.06904523817553E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00212316373240348
atypical teratoid / rhabdoid tumor 4369 0.0114339493115612
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.012919972748238
subependymal giant cell astrocytoma 2287 0.0229605358245646

Expression

Synonym

Accession Q6QAJ8 A1YRJ4 B2RNE4 B4DJ52 B9EGW3
Symbols

Gene

  Ortholog (10)

AA Sequence

MAPALWRACNGLMAAFFALAALVQVNDPDAEVWVVVYTIPAVLTLLVGLNPEVTGNVIWKSISAIHILFC      1 - 70
TVWAVGLASYLLHRTQQNILHEEEGRELSGLVIITAWIILCHSSSKNPVGGRIQLAIAIVITLFPFISWV     71 - 140
YIYINKEMRSSWPTHCKTVI                                                      141 - 160
//

Text Mined References (4)

PMID Year Title
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.