Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.24
PubTator Score 1.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

AA Sequence

MSAPRLLISIIIMVSASSSSCMGGKQMTQNYSTIFAEGNISQPVLMDINAVLCCPPIALRNLIIITWEII      1 - 70
LRGQPSCTKAYKKETNETKETNCTVERITWVSRPDQNSDLQIRPVDTTHDGYYRGIVVTPDGNFHRGYHL     71 - 140
QVLVTPEVNLFQSRNITAVCKAVTGKPAAQISWIPEGSILATKQEYWGNGTVTVKSTCPWEGHKSTVTCH    141 - 210
VSHLTGNKSLSVKLNSGLRTSGSPALSLLIILYVKLSLFVVILVTTGFVFFQRINHVRKVL             211 - 271
//

Text Mined References (7)

PMID Year Title
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
16928187 2006 Is the CD200/CD200 receptor interaction more than just a myeloid cell inhibitory signal?
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15471863 2004 CD200 receptor family members represent novel DAP12-associated activating receptors on basophils and mast cells.
15274657 2004 Structural and functional heterogeneity in the CD200R family of immunoregulatory molecules and their expression at the feto-maternal interface.
12960329 2003 Characterization of the CD200 receptor family in mice and humans and their interactions with CD200.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.