Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.24
PubTator Score 1.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 1.0
Disease Target Count Z-score Confidence
Sleeping sickness 37 3.592 1.8

Synonym

Accession Q6Q8B3 Q6WHB7
Symbols CD200R2
CD200RLa

Gene

PANTHER Protein Class (1)

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Chicken EggNOG Inparanoid
Xenopus OMA EggNOG

AA Sequence

MSAPRLLISIIIMVSASSSSCMGGKQMTQNYSTIFAEGNISQPVLMDINAVLCCPPIALRNLIIITWEII      1 - 70
LRGQPSCTKAYKKETNETKETNCTVERITWVSRPDQNSDLQIRPVDTTHDGYYRGIVVTPDGNFHRGYHL     71 - 140
QVLVTPEVNLFQSRNITAVCKAVTGKPAAQISWIPEGSILATKQEYWGNGTVTVKSTCPWEGHKSTVTCH    141 - 210
VSHLTGNKSLSVKLNSGLRTSGSPALSLLIILYVKLSLFVVILVTTGFVFFQRINHVRKVL             211 - 271
//

Text Mined References (7)

PMID Year Title
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
16928187 2006 Is the CD200/CD200 receptor interaction more than just a myeloid cell inhibitory signal?
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15471863 2004 CD200 receptor family members represent novel DAP12-associated activating receptors on basophils and mast cells.
15274657 2004 Structural and functional heterogeneity in the CD200R family of immunoregulatory molecules and their expression at the feto-maternal interface.
12960329 2003 Characterization of the CD200 receptor family in mice and humans and their interactions with CD200.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.