Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.27
PubTator Score 1.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 1.2
Disease Target Count Z-score Confidence
Sleeping sickness 37 3.591 1.8

AA Sequence

MSAPRLLISIIIMVSASSSSCMGGKQMTQNYSTIFAEGNISQPVLMDINAVLCCPPIALRNLIIITWEII      1 - 70
LRGQPSCTKAYKKETNETKETNCTVERITWVSRPDQNSDLQIRPVDTTHDGYYRGIVVTPDGNFHRGYHL     71 - 140
QVLVTPEVNLFQSRNITAVCKAVTGKPAAQISWIPEGSILATKQEYWGNGTVTVKSTCPWEGHKSTVTCH    141 - 210
VSHLTGNKSLSVKLNSGLRTSGSPALSLLIILYVKLSLFVVILVTTGFVFFQRINHVRKVL             211 - 271
//

Text Mined References (7)

PMID Year Title