Knowledge Summary

Patent

No data available

Synonym

Accession Q6Q795
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MEEVIQAGLAQWSRQKGLALPWDRTRGHPDVPWRNLTSSPTRPLAQPAGSCMPAEPSPAAHYHQLHVHLQ      1 - 70
LLPSDLSERPGLRLAPLALVEVGMTLPVPQTPLPHVTQQQKLAPGRQLCPW                        71 - 121
//

Text Mined References (1)

PMID Year Title