Property Summary

NCBI Gene PubMed Count 379
Grant Count 30
R01 Count 22
Funding $3,883,523.05
PubMed Score 400.30
PubTator Score 510.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.036 0.000
pancreatic ductal adenocarcinoma liver m... -3.631 0.001
psoriasis -1.300 0.031

Gene RIF (446)

PMID Text
26824674 APOA5 rs662799 polymorphism has interactions with the environmental factors associated with metabolic syndrome X.
26782469 The results of our meta-analysis point to a strong link between both APOA5 -1131T>C and APOC3 -455T>C polymorphisms and an increased risk ofcoronary heart disease .
26702748 APOA5 rs2075291 could play an important role in triglyceride and HDL-C level in metabolic syndrome, while the association of APOA5 rs662799 polymorphism is still under debate.
26634697 When the inter-dependence between alleles was examined using conditional models, five loci on BUD13, ZNF259, and ApoA5 showed possible independent associations.
26524954 A potential role for APOA5 common variants and related haplotypes as risk factors for obesity.
26505382 meta-analysis provides substantial evidence that the APOA5 -1131T/C polymorphism might contribute to coronary artery disease development in the Chinese population
26397108 Single nucleotide polymorphisms (Rs651821) of APOA5 protein did not increase the risk of CHD in the Chinese population.
26387083 APOA5 -1131 T > C and APOC3 -455 T > C SNPs may play potent roles in the development and progression of coronary heart disease. (Meta-analysis)
26365669 Dietary fat intake modifies the effect of APOA5 and LEPR polymorphisms on serum triglycerides, cholesterol levels and obesity in young subjects.
26365620 The polymorphisms rs662799 near APOA5 and rs769450 in APOE had significant association with metabolic syndrome X and its components in Korean males.
More...

AA Sequence

MASMAAVLTWALALLSAFSATQARKGFWDYFSQTSGDKGRVEQIHQQKMAREPATLKDSLEQDLNNMNKF      1 - 70
LEKLRPLSGSEAPRLPQDPVGMRRQLQEELEEVKARLQPYMAEAHELVGWNLEGLRQQLKPYTMDLMEQV     71 - 140
ALRVQELQEQLRVVGEDTKAQLLGGVDEAWALLQGLQSRVVHHTGRFKELFHPYAESLVSGIGRHVQELH    141 - 210
RSVAPHAPASPARLSRCVQVLSRKLTLKAKALHARIQQNLDQLREELSRAFAGTGTEEGAGPDPQMLSEE    211 - 280
VRQRLQAFRQDTYLQIAAFTRAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWED    281 - 350
ITHSLHDQGHSHLGDP                                                          351 - 366
//

Text Mined References (382)

PMID Year Title
26824674 2016 Interactions of Environmental Factors and APOA1-APOC3-APOA4-APOA5 Gene Cluster Gene Polymorphisms with Metabolic Syndrome.
26782469 2015 APOA5 -1131T>C and APOC3 -455T>C polymorphisms are associated with an increased risk of coronary heart disease.
26702748 2016 The Relation between Metabolic Syndrome Risk Factors and Genetic Variations of Apolipoprotein V in Relation with Serum Triglyceride and HDL-C Level.
26634697 2016 Multiple susceptibility loci at chromosome 11q23.3 are associated with plasma triglyceride in East Asians.
26524954 2015 Association analysis of APOA5 rs662799 and rs3135506 polymorphisms with obesity in Moroccan patients.
26397108 2015 Effects of Polymorphisms in APOA4-APOA5-ZNF259-BUD13 Gene Cluster on Plasma Levels of Triglycerides and Risk of Coronary Heart Disease in a Chinese Han Population.
26387083 2015 Apolipoprotein A5 and apolipoprotein C3 single nucleotide polymorphisms are correlated with an increased risk of coronary heart disease: a case-control and meta-analysis study.
26365669 2015 Interaction of dietary fat intake with APOA2, APOA5 and LEPR polymorphisms and its relationship with obesity and dyslipidemia in young subjects.
26365620 2015 Genetic association of APOA5 and APOE with metabolic syndrome and their interaction with health-related behavior in Korean men.
26350810 Apolipoprotein A-V concentration in preterm infants.
More...