Property Summary

NCBI Gene PubMed Count 398
PubMed Score 424.95
PubTator Score 510.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.036 1.8e-05
pancreatic ductal adenocarcinoma liver m... -2.318 5.6e-03
psoriasis -1.300 3.1e-02

Gene RIF (464)

AA Sequence

MASMAAVLTWALALLSAFSATQARKGFWDYFSQTSGDKGRVEQIHQQKMAREPATLKDSLEQDLNNMNKF      1 - 70
LEKLRPLSGSEAPRLPQDPVGMRRQLQEELEEVKARLQPYMAEAHELVGWNLEGLRQQLKPYTMDLMEQV     71 - 140
ALRVQELQEQLRVVGEDTKAQLLGGVDEAWALLQGLQSRVVHHTGRFKELFHPYAESLVSGIGRHVQELH    141 - 210
RSVAPHAPASPARLSRCVQVLSRKLTLKAKALHARIQQNLDQLREELSRAFAGTGTEEGAGPDPQMLSEE    211 - 280
VRQRLQAFRQDTYLQIAAFTRAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWED    281 - 350
ITHSLHDQGHSHLGDP                                                          351 - 366
//

Text Mined References (401)

PMID Year Title