Property Summary

NCBI Gene PubMed Count 3
PubMed Score 33.32
PubTator Score 60.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Gout 93 0.0 1.0

Expression

Synonym

Accession Q6Q6R5 A2A436 Q5T043 Q6Q6R4 Q6Q6R6 Q6Q6R7 CRP-3
Symbols TLP
TLP-A
bA480N24.2

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid

AA Sequence

MSWTCPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSPGGHAEHNGRPYCHKPCYGALFGPRGVNIG      1 - 70
GVGSYLYNPPTPSPGCTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGETSLCPGCGEPVYFAEKVMSL     71 - 140
GRNWHRPCLRCQRCHKTLTAGSHAEHDGVPYCHVPCYGYLFGPKGGQPHPRHWDGMYMPEVWHVHGLWVC    141 - 210
VDNFPCG                                                                   211 - 217
//

Text Mined References (3)

PMID Year Title
15380775 2004 The human and mouse orthologous LIM-only proteins respectively encoded in chromosome 6 and 17 show a different expression pattern.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14574404 2003 The DNA sequence and analysis of human chromosome 6.