Property Summary

NCBI Gene PubMed Count 3
Grant Count 2
Funding $358,887
PubMed Score 33.32
PubTator Score 60.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Gout 93 1.0

Expression

AA Sequence

MSWTCPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSPGGHAEHNGRPYCHKPCYGALFGPRGVNIG      1 - 70
GVGSYLYNPPTPSPGCTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGETSLCPGCGEPVYFAEKVMSL     71 - 140
GRNWHRPCLRCQRCHKTLTAGSHAEHDGVPYCHVPCYGYLFGPKGGQPHPRHWDGMYMPEVWHVHGLWVC    141 - 210
VDNFPCG                                                                   211 - 217
//

Text Mined References (3)

PMID Year Title
15380775 2004 The human and mouse orthologous LIM-only proteins respectively encoded in chromosome 6 and 17 show a different expression pattern.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14574404 2003 The DNA sequence and analysis of human chromosome 6.