Property Summary

NCBI Gene PubMed Count 3
PubMed Score 34.15
PubTator Score 60.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Gout 104 0.0 1.7

Expression

AA Sequence

MSWTCPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSPGGHAEHNGRPYCHKPCYGALFGPRGVNIG      1 - 70
GVGSYLYNPPTPSPGCTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGETSLCPGCGEPVYFAEKVMSL     71 - 140
GRNWHRPCLRCQRCHKTLTAGSHAEHDGVPYCHVPCYGYLFGPKGGQPHPRHWDGMYMPEVWHVHGLWVC    141 - 210
VDNFPCG                                                                   211 - 217
//

Text Mined References (3)

PMID Year Title