Property Summary

NCBI Gene PubMed Count 15
PubMed Score 67.18
PubTator Score 15.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 1.00690996431092E-4
Atopic dermatitis 944 1.15001940844478E-4
ductal carcinoma in situ 1745 0.00208302879446627
breast carcinoma 1614 0.00537695046082653
invasive ductal carcinoma 2950 0.0114965369116198
fibroadenoma 557 0.0272900257891612
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.904 0.000
Atopic dermatitis -2.100 0.000
breast carcinoma -1.700 0.005
fibroadenoma -2.400 0.027
ductal carcinoma in situ -3.100 0.002
invasive ductal carcinoma -3.300 0.011

Synonym

Accession Q6Q4G3 A8K6J0 C9JGD2 Q32MR1 Q4G0I9 Q4G0V2 Q86XA3 Q8NBZ2 AP-Q
Symbols APQ
AQPEP
TAQPEP

Gene

PANTHER Protein Class (3)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG

Gene RIF (10)

PMID Text
24959655 In preeclamptic placentas, laeverin is experssed in the cytoplasm and microvesicles, rather than the cell membrane. Laeverin appears to be involved in trophoblast cell migration and invasion through interaction with integrins and matrix metalloprotease 1.
22402206 Laeverin is a specific cell-surface marker for human extravillous trophoblast (EVT) and plays a regulatory role in EVT migration.
21212512 Replacement of glutamine-238 with alanine caused a significant change in substrate specificity rather than a decrease in enzymatic activity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19819873 These results indicate that His(379) of laeverin plays essential roles in its distinctive enzymatic properties and contributes to maintaining the appropriate structure of the catalytic cavity of the enzyme.
19578876 Observational study of gene-disease association. (HuGE Navigator)
17525158 is a novel bestatin-sensitive leucine aminopeptidase; plays important roles in human placentation by regulating biological activity of key peptides at the embryo-maternal interface
16804865 The 3 most significantly overexpressed genes in rheumatoid arthritis were laeverin, 11beta-hydroxysteroid dehydrogenase type 2 (a steroid pathway enzyme), and cysteine-rich, angiogenic inducer 61 (a known angiogenic factor).
15897020 A novel membrane-bound cell surface peptidase, laeverin (FLJ90650), was found to be specifically expressed on extravillous trophoblasts that had almost ceased invasion into maternal decidual tissues.
14706636 Extravillous trophoblasts express laeverin, a novel protein that belongs to membrane-bound gluzincin metallopeptidases(laeverin)

AA Sequence

MGPPSSSGFYVSRAVALLLAGLVAALLLALAVLAALYGHCERVPPSELPGLRDLEAESSPPLRQKPTPTP      1 - 70
KPSSARELAVTTTPSNWRPPGPWDQLRLPPWLVPLHYDLELWPQLRPDELPAGSLPFTGRVNITVRCTVA     71 - 140
TSRLLLHSLFQDCERAEVRGPLSPGTGNATVGRVPVDDVWFALDTEYMVLELSEPLKPGSSYELQLSFSG    141 - 210
LVKEDLREGLFLNVYTDQGERRALLASQLEPTFARYVFPCFDEPALKATFNITMIHHPSYVALSNMPKLG    211 - 280
QSEKEDVNGSKWTVTTFSTTPHMPTYLVAFVICDYDHVNRTERGKEIRIWARKDAIANGSADFALNITGP    281 - 350
IFSFLEDLFNISYSLPKTDIIALPSFDNHAMENWGLMIFDESGLLLEPKDQLTEKKTLISYVVSHEIGHQ    351 - 420
WFGNLVTMNWWNNIWLNEGFASYFEFEVINYFNPKLPRNEIFFSNILHNILREDHALVTRAVAMKVENFK    421 - 490
TSEIQELFDIFTYSKGASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQDDLWRHFQMAIDDQSTVILP    491 - 560
ATIKNIMDSWTHQSGFPVITLNVSTGVMKQEPFYLENIKNRTLLTSNDTWIVPILWIKNGTTQPLVWLDQ    561 - 630
SSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKKLNQQLEKDPKAIPVIHRLQLIDDAFSLSKNN    631 - 700
YIEIETALELTKYLAEEDEIIVWHTVLVNLVTRDLVSEVNIYDIYSLLKRYLLKRLNLIWNIYSTIIREN    701 - 770
VLALQDDYLALISLEKLFVTACWLGLEDCLQLSKELFAKWVDHPENEIPYPIKDVVLCYGIALGSDKEWD    771 - 840
ILLNTYTNTTNKEEKIQLAYAMSCSKDPWILNRYMEYAISTSPFTSNETNIIEVVASSEVGRYVAKDFLV    841 - 910
NNWQAVSKRYGTQSLINLIYTIGRTVTTDLQIVELQQFFSNMLEEHQRIRVHANLQTIKNENLKNKKLSA    911 - 980
RIAAWLRRNT                                                                981 - 990
//

Text Mined References (16)

PMID Year Title
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25367360 2015 Genome-wide association study for refractive astigmatism reveals genetic co-determination with spherical equivalent refractive error: the CREAM consortium.
24959655 2014 Placental expression of aminopeptidase-Q (laeverin) and its role in the pathophysiology of preeclampsia.
22402206 2012 Laeverin/aminopeptidase Q induces trophoblast invasion during human early placentation.
21212512 2011 Involvement of glutamine-238 in the substrate specificity of human laeverin/aminopeptidase Q.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19819873 2009 Histidine 379 of human laeverin/aminopeptidase Q, a nonconserved residue within the exopeptidase motif, defines its distinctive enzymatic properties.
19578876 2009 The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations.
17525158 2007 Laeverin/aminopeptidase Q, a novel bestatin-sensitive leucine aminopeptidase belonging to the M1 family of aminopeptidases.
16804865 2006 Identification of genes modulated in rheumatoid arthritis using complementary DNA microarray analysis of lymphoblastoid B cell lines from disease-discordant monozygotic twins.
More...