Property Summary

NCBI Gene PubMed Count 16
Grant Count 2
Funding $19,159.2
PubMed Score 9.67
PubTator Score 9.74

Knowledge Summary


No data available


  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.534 0.000
breast carcinoma 1.400 0.003
group 3 medulloblastoma 1.100 0.008
lung adenocarcinoma 1.100 0.000


Accession Q6Q0C0 Q9H073
Symbols RFWD1


 Grant Application (2)

Gene RIF (9)

25318608 TRAF7 is a direct target of miR-126 in human umbilical cord vascular endothelial cells.
23404370 The findings of this study suggested an essential contribution of combined KLF4 K409Q and TRAF7 mutations in the genesis of secretory meningioma and demonstrate a role for TRAF7 alterations in other non-NF2 meningiomas.
23348505 Nearly one-fourth of all meningiomas have mutations in TRAF7.
23128672 Downregulation of ubiquitin E3 ligase TNF receptor-associated factor 7 leads to stabilization of p53 in breast cancer.
22219201 an important role for TRAF7 in the activation of JNK following TNFalpha stimulation and involvement of this protein in regulating the turnover of c-FLIP
22105767 TRAF7 is involved in signal transduction pathways that lead either to activation or repression of NF-kappaB transcription factor.
21518757 this study identifies TRAF7 as a NEMO- and p65-interacting molecule and brings important information on the ubiquitination events that control NF-kappaB transcriptional activity.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15001576 TRAF7 potentiates MEKK3-induced AP1 and CHOP activation and induces apoptosis

AA Sequence

DNMICTQTLLRHQGSVTALAVSRGRLFSGAVDSTVKVWTC                                  631 - 670

Publication (18)

PMID Year Title
25318608 2015 MicroRNA-126 attenuates palmitate-induced apoptosis by targeting TRAF7 in HUVECs.
23404370 2013 Secretory meningiomas are defined by combined KLF4 K409Q and TRAF7 mutations.
23348505 2013 Genomic analysis of non-NF2 meningiomas reveals mutations in TRAF7, KLF4, AKT1, and SMO.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128672 2013 Downregulation of ubiquitin E3 ligase TNF receptor-associated factor 7 leads to stabilization of p53 in breast cancer.
22219201 2012 Tumor necrosis factor (TNF) receptor-associated factor 7 is required for TNF?-induced Jun NH2-terminal kinase activation and promotes cell death by regulating polyubiquitination and lysosomal degradation of c-FLIP protein.
22105767 2012 The seventh ring: exploring TRAF7 functions.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21518757 2011 TRAF7 protein promotes Lys-29-linked polyubiquitination of IkappaB kinase (IKKgamma)/NF-kappaB essential modulator (NEMO) and p65/RelA protein and represses NF-kappaB activation.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.