Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.37
PubTator Score 6.79

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
16186102 a hydrophobic residue is a key determinant of fructose transport in SLC2A7
15033637 Unusual substrate specificity and close sequence identity with GLUT5. GLUT7 may represent intermediate between class II GLUTs and class I member GLUT2. Comparison may give key to structural determinants for recognition of fructose as a substrate.

AA Sequence

MENKEAGTPPPIPSREGRLQPTLLLATLSAAFGSAFQYGYNLSVVNTPHKVFKSFYNETYFERHATFMDG      1 - 70
KLMLLLWSCTVSMFPLGGLLGSLLVGLLVDSCGRKGTLLINNIFAIIPAILMGVSKVAKAFELIVFSRVV     71 - 140
LGVCAGISYSALPMYLGELAPKNLRGMVGTMTEVFVIVGVFLAQIFSLQAILGNPAGWPVLLALTGVPAL    141 - 210
LQLLTLPFFPESPRYSLIQKGDEATARQALRRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSL    211 - 280
RWQLLSIIVLMAGQQLSGINAINYYADTIYTSAGVEAAHSQYVTVGSGVVNIVMTITSAVLVERLGRRHL    281 - 350
LLAGYGICGSACLVLTVVLLFQNRVPELSYLGIICVFAYIAGHSIGPSPVPSVVRTEIFLQSSRRAAFMV    351 - 420
DGAVHWLTNFIIGFLFPSIQEAIGAYSFIIFAGICLLTAIYIYVVIPETKGKTFVEINRIFAKRNRVKLP    421 - 490
EEKEETIDAGPPTASPAKETSF                                                    491 - 512
//

Text Mined References (6)

PMID Year Title
18477702 2008 GLUT7: a new intestinal facilitated hexose transporter.
18460594 2008 Insight into the "odd" hexose transporters GLUT3, GLUT5, and GLUT7.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16186102 2005 Identification of a hydrophobic residue as a key determinant of fructose transport by the facilitative hexose transporter SLC2A7 (GLUT7).
15033637 2004 Cloning and functional characterization of the human GLUT7 isoform SLC2A7 from the small intestine.
11780753 The extended GLUT-family of sugar/polyol transport facilitators: nomenclature, sequence characteristics, and potential function of its novel members (review).