Property Summary

NCBI Gene PubMed Count 10
Grant Count 5
R01 Count 5
Funding $349,053.34
PubMed Score 41.00
PubTator Score 5.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (7)

PMID Text
26652387 The synthesis of hydroxyapatite with different crystallinities by controlling the concentration of recombinant CEMP1 for biological application.
26011628 CEMP1 exerts modulation of a number of cellular genes.
24117017 when HIF-1 was activated by gene introduction or chemically, CEMP1 expression and mineralization increased.
22349547 human primary cementoblasts subjected to compression and IL-1beta stimulation impeded BSP and CEMP-1 expression, proteins that are associated with cementogenesis.
21465469 These data demonstrate for the first time that the CEMP1 is not only a marker protein for cementoblast-related cells, but it also regulates cementoblast commitment in periodontal ligament cells
19393626 CEMP1 plays a role during the biomineralization process by promoting octacalcium phosphate crystal nucleation.
17509525 CEMP1 might participate in differentiation and mineralization of nonosteogenic cells, and it might have a potential function in cementum and bone formation

AA Sequence

MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPH      1 - 70
TSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLN     71 - 140
WALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAP    141 - 210
EAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG                                     211 - 247
//

Text Mined References (11)

PMID Year Title
26652387 2016 The synthesis of hydroxyapatite with different crystallinities by controlling the concentration of recombinant CEMP1 for biological application.
26011628 2015 CEMP1 Induces Transformation in Human Gingival Fibroblasts.
24117017 2014 Hypoxia promotes CEMP1 expression and induces cementoblastic differentiation of human dental stem cells in an HIF-1-dependent manner.
22349547 2012 Human primary cementoblasts respond to combined IL-1? stimulation and compression with an impaired BSP and CEMP-1 expression.
21465469 2012 Cementum protein 1 (CEMP1) induces a cementoblastic phenotype and reduces osteoblastic differentiation in periodontal ligament cells.
19393626 2009 Characterization of recombinant human cementum protein 1 (hrCEMP1): primary role in biomineralization.
17509525 2007 Human Cementum Protein 1 induces expression of bone and cementum proteins by human gingival fibroblasts.
16263347 2006 Molecular cloning, expression and immunolocalization of a novel human cementum-derived protein (CP-23).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...