Property Summary

NCBI Gene PubMed Count 11
PubMed Score 44.24
PubTator Score 5.08

Knowledge Summary

Patent

No data available

Gene RIF (7)

AA Sequence

MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPH      1 - 70
TSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLN     71 - 140
WALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAP    141 - 210
EAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG                                     211 - 247
//

Text Mined References (12)

PMID Year Title