Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.41
PubTator Score 1.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.4e-09
lung carcinoma 2843 4.2e-07
Atopic dermatitis 952 7.5e-05
lung adenocarcinoma 2716 1.2e-04
pituitary cancer 1972 4.7e-04

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis -1.300 7.5e-05
lung adenocarcinoma 1.300 1.2e-04
lung carcinoma -1.300 4.2e-07
pituitary cancer -1.100 4.7e-04
psoriasis 1.300 3.4e-09

Gene RIF (1)

AA Sequence

MDRVYEIPEEPNVDPVSSLEEDVIRGANPRFTFPFSILFSTFLYCGEAASALYMVRIYRKNSETYWMTYT      1 - 70
FSFFMFSSIMVQLTLIFVHRDLAKDKPLSLFMHLILLGPVIRCLEAMIKYLTLWKKEEQEEPYVSLTRKK     71 - 140
MLIDGEEVLIEWEVGHSIRTLAMHRNAYKRMSQIQAFLGSVPQLTYQLYVSLISAEVPLGRVVLMVFSLV    141 - 210
SVTYGATLCNMLAIQIKYDDYKIRLGPLEVLCITIWRTLEITSRLLILVLFSATLKLKAVPFLVLNFLII    211 - 280
LFEPWIKFWRSGAQMPNNIEKNFSRVGTLVVLISVTILYAGINFSCWSALQLRLADRDLVDKGQNWGHMG    281 - 350
LHYSVRLVENVIMVLVFKFFGVKVLLNYCHSLIALQLIIAYLISIGFMLLFFQYLHPLRSLFTHNVVDYL    351 - 420
HCVCCHQHPRTRVENSEPPFETEARQSVV                                             421 - 449
//

Text Mined References (5)

PMID Year Title