Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.41
PubTator Score 1.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis -1.300 0.000
lung adenocarcinoma 1.300 0.000
psoriasis 1.300 0.000
lung carcinoma -1.300 0.000
pituitary cancer -1.100 0.000

Gene RIF (1)

PMID Text
16431037 XPLAC is expressed mostly in placenta and adrenal gland while XTES is exclusively expressed in primate testis

AA Sequence

MDRVYEIPEEPNVDPVSSLEEDVIRGANPRFTFPFSILFSTFLYCGEAASALYMVRIYRKNSETYWMTYT      1 - 70
FSFFMFSSIMVQLTLIFVHRDLAKDKPLSLFMHLILLGPVIRCLEAMIKYLTLWKKEEQEEPYVSLTRKK     71 - 140
MLIDGEEVLIEWEVGHSIRTLAMHRNAYKRMSQIQAFLGSVPQLTYQLYVSLISAEVPLGRVVLMVFSLV    141 - 210
SVTYGATLCNMLAIQIKYDDYKIRLGPLEVLCITIWRTLEITSRLLILVLFSATLKLKAVPFLVLNFLII    211 - 280
LFEPWIKFWRSGAQMPNNIEKNFSRVGTLVVLISVTILYAGINFSCWSALQLRLADRDLVDKGQNWGHMG    281 - 350
LHYSVRLVENVIMVLVFKFFGVKVLLNYCHSLIALQLIIAYLISIGFMLLFFQYLHPLRSLFTHNVVDYL    351 - 420
HCVCCHQHPRTRVENSEPPFETEARQSVV                                             421 - 449
//

Text Mined References (5)

PMID Year Title
16431037 2006 Identification of two new members, XPLAC and XTES, of the XK family.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.