Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.10
PubTator Score 5.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.300 2.0e-02
breast carcinoma 1.100 5.3e-25
cystic fibrosis -1.278 2.9e-05
ductal carcinoma in situ 1.300 5.1e-03
ependymoma -1.400 3.0e-02
glioblastoma -1.100 3.8e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.5e-02
invasive ductal carcinoma 1.800 6.0e-03
Multiple myeloma 1.337 3.1e-03
oligodendroglioma -1.400 1.5e-02
osteosarcoma -1.065 2.4e-03
ovarian cancer -1.100 5.8e-03
psoriasis -1.700 6.3e-05

Gene RIF (5)

AA Sequence

MLPGLAAAAAHRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFGSFSNMVPCSHPYIGTLSQVKLYSTN      1 - 70
VQKEGQGSQTLRVEKVPSFETAEGIGTELKAPLKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEF     71 - 140
CLKSSDLEQLRKIRRRSPHEDTESFTVYLRSDVEAKSLEVWGSPEALAREKKLRKEAEIEYRERLFRNQK    141 - 210
ILREYRDFLGNTKPRSRTASVFFKGPGKVVMVAICINGLNCFFKFLAWIYTGSASMFSEAIHSLSDTCNQ    211 - 280
GLLALGISKSVQTPDPSHPYGFSNMRYISSLISGVGIFMMGAGLSWYHGVMGLLHPQPIESLLWAYCILA    281 - 350
GSLVSEGATLLVAVNELRRNARAKGMSFYKYVMESRDPSTNVILLEDTAAVLGVIIAATCMGLTSITGNP    351 - 420
LYDSLGSLGVGTLLGMVSAFLIYTNTEALLGRSIQPEQVQRLTELLENDPSVRAIHDVKATDLGLGKVRF    421 - 490
KAEVDFDGRVVTRSYLEKQDFDQMLQEIQEVKTPEELETFMLKHGENIIDTLGAEVDRLEKELKKRNPEV    491 - 560
RHVDLEIL                                                                  561 - 568
//

Text Mined References (14)

PMID Year Title