Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.30
PubTator Score 5.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.337 0.003
astrocytic glioma -1.300 0.020
ependymoma -1.400 0.030
oligodendroglioma -1.400 0.015
psoriasis -1.700 0.000
osteosarcoma -1.065 0.002
cystic fibrosis -1.278 0.000
glioblastoma -1.100 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.015
breast carcinoma 1.100 0.000
ductal carcinoma in situ 1.300 0.005
invasive ductal carcinoma 1.800 0.006
ovarian cancer -1.100 0.006

Synonym

Accession Q6PML9 Q4W5B6 Q7Z5I7 Q8TBB2 Q9Y6R2 ZnT-9
Symbols HUEL
ZNT9
GAC63
C4orf1

Gene

PDB

2ENK  

Gene RIF (4)

PMID Text
25921144 ZNT9 expression in glioma tumors was not associated with tumor grade or IDH1 mutation status.
19064571 Observational study of gene-disease association. (HuGE Navigator)
17971500 hZnT-9 was expressed at low levels in leukocytes.
11906820 Results indicate that HUEL, which shares significant homology with the DNA-binding domain of XPA, is likely to be a conserved, housekeeping gene that is intimately linked with cellular replication, DNA synthesis and/or transcriptional regulation.

AA Sequence

MLPGLAAAAAHRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFGSFSNMVPCSHPYIGTLSQVKLYSTN      1 - 70
VQKEGQGSQTLRVEKVPSFETAEGIGTELKAPLKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEF     71 - 140
CLKSSDLEQLRKIRRRSPHEDTESFTVYLRSDVEAKSLEVWGSPEALAREKKLRKEAEIEYRERLFRNQK    141 - 210
ILREYRDFLGNTKPRSRTASVFFKGPGKVVMVAICINGLNCFFKFLAWIYTGSASMFSEAIHSLSDTCNQ    211 - 280
GLLALGISKSVQTPDPSHPYGFSNMRYISSLISGVGIFMMGAGLSWYHGVMGLLHPQPIESLLWAYCILA    281 - 350
GSLVSEGATLLVAVNELRRNARAKGMSFYKYVMESRDPSTNVILLEDTAAVLGVIIAATCMGLTSITGNP    351 - 420
LYDSLGSLGVGTLLGMVSAFLIYTNTEALLGRSIQPEQVQRLTELLENDPSVRAIHDVKATDLGLGKVRF    421 - 490
KAEVDFDGRVVTRSYLEKQDFDQMLQEIQEVKTPEELETFMLKHGENIIDTLGAEVDRLEKELKKRNPEV    491 - 560
RHVDLEIL                                                                  561 - 568
//

Text Mined References (13)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25921144 2015 Expression Profile Analysis of Zinc Transporters (ZIP4, ZIP9, ZIP11, ZnT9) in Gliomas and their Correlation with IDH1 Mutation Status.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17971500 2008 Intracellular zinc homeostasis in leukocyte subsets is regulated by different expression of zinc exporters ZnT-1 to ZnT-9.
17349999 2007 Zinc transporter 2 (SLC30A2) can suppress the vesicular zinc defect of adaptor protein 3-depleted fibroblasts by promoting zinc accumulation in lysosomes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...